WB (Western Blot)
(Host: RabbitTarget Name: GPR31Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human GPR31 Polyclonal Antibody | anti-GPR31 antibody
GPR31 Antibody - C-terminal region
Gene Names
GPR31; HETER; HETER1; 12-HETER
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPR31, Antibody; GPR31 Antibody - C-terminal region; anti-GPR31 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch depend within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: QKRLREPEKQPKLQRAQALVTLVVVLFALCFLPCFLARVLMHIFQNLGSC
Sequence Length
319
Applicable Applications for anti-GPR31 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR31
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: GPR31Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: GPR31Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GPR31 antibody
This is a rabbit polyclonal antibody against GPR31. It was validated on Western Blot
Target Description: GPR31 is a high-affinity receptor for 12-(S)-hydroxy-5,8,10,14- eicosatetraenoic acid (12-S-HETE). 12-(S)-HETE is an arachidonic acid metabolite secreted by platelets and tumor cells, and known to induce endothelial cells retraction allowing invasive cell access to the subendothelial matrix, which is a critical step for extravasation or metastasis. Ligand-binding lead to activation of ERK1/2 (MAPK3/MAPK1), MEK, and NF-kappa-B.
Target Description: GPR31 is a high-affinity receptor for 12-(S)-hydroxy-5,8,10,14- eicosatetraenoic acid (12-S-HETE). 12-(S)-HETE is an arachidonic acid metabolite secreted by platelets and tumor cells, and known to induce endothelial cells retraction allowing invasive cell access to the subendothelial matrix, which is a critical step for extravasation or metastasis. Ligand-binding lead to activation of ERK1/2 (MAPK3/MAPK1), MEK, and NF-kappa-B.
Product Categories/Family for anti-GPR31 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
NCBI Official Synonym Full Names
G protein-coupled receptor 31
NCBI Official Symbol
GPR31
NCBI Official Synonym Symbols
HETER; HETER1; 12-HETER
NCBI Protein Information
12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
UniProt Protein Name
12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor
UniProt Gene Name
GPR31
UniProt Synonym Gene Names
12-(S)-HETE receptor; 12-HETER
UniProt Entry Name
GPR31_HUMAN
Similar Products
Product Notes
The GPR31 gpr31 (Catalog #AAA201379) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR31 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPR31 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GPR31 gpr31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKRLREPEKQ PKLQRAQALV TLVVVLFALC FLPCFLARVL MHIFQNLGSC. It is sometimes possible for the material contained within the vial of "GPR31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.