Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201298_WB13.jpg WB (Western Blot) (WB Suggested Anti-GPR35 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

Rabbit anti-Human GPR35 Polyclonal Antibody | anti-GPR35 antibody

GPR35 Antibody - C-terminal region

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPR35, Antibody; GPR35 Antibody - C-terminal region; anti-GPR35 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAAR
Sequence Length
340
Applicable Applications for anti-GPR35 antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR35
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GPR35 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

product-image-AAA201298_WB13.jpg WB (Western Blot) (WB Suggested Anti-GPR35 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

WB (Western Blot)

(Host: RabbitTarget Name: GPR35Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201298_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: GPR35Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-GPR35 antibody
This is a rabbit polyclonal antibody against GPR35. It was validated on Western Blot

Target Description: GPR35 acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.
Product Categories/Family for anti-GPR35 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
G-protein coupled receptor 35 isoform b
NCBI Official Synonym Full Names
G protein-coupled receptor 35
NCBI Official Symbol
GPR35
NCBI Protein Information
G-protein coupled receptor 35
UniProt Protein Name
G-protein coupled receptor 35
UniProt Gene Name
GPR35
UniProt Synonym Gene Names
KYNA receptor
UniProt Entry Name
GPR35_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GPR35 gpr35 (Catalog #AAA201298) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR35 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPR35 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GPR35 gpr35 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HNFNSMAFPL LGFYLPLAVV VFCSLKVVTA LAQRPPTDVG QAEATRKAAR. It is sometimes possible for the material contained within the vial of "GPR35, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.