WB (Western Blot)
(WB Suggested Anti-GPR65 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)
Rabbit GPR65 Polyclonal Antibody | anti-GPR65 antibody
GPR65 antibody - C-terminal region
Gene Names
GPR65; TDAG8; hTDAG8
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPR65, Antibody; GPR65 antibody - C-terminal region; anti-GPR65 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human
Predicted Reactivity: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence Length
LEKWQINLNLFRTCTGYAIPLVTILICNRKVYQAVRHNKATENKEKKRII
Applicable Applications for anti-GPR65 antibody
WB (Western Blot)
Protein Size (# AA)
337 amino acids
Blocking Peptide
For anti-GPR65 (MBS3216551) antibody is
Predicted Homology
Dog: 77%; Horse: 77%; Human: 100%; Mouse: 79%; Pig: 77%; Rabbit: 79%; Rat: 79%
Description of Target
GPR65 is a receptor for the glycosphingolipid psychosine (PSY) and several related glycosphingolipids. GPR65 may have a role in activation-induced cell death or differentiation of T-cells.
Peptide Sequence
Synthetic peptide located within the following region: LEKWQINLNLFRTCTGYAIPLVTILICNRKVYQAVRHNKATENKEKKRII
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles
WB (Western Blot)
(WB Suggested Anti-GPR65 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)
WB (Western Blot)
(WB Suggested Anti-GPR65 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)
Related Product Information for anti-GPR65 antibody
GPR65 is a receptor for the glycosphingolipid psychosine (PSY) and several related glycosphingolipids. GPR65 may have a role in activation-induced cell death or differentiation of T-cells.
Product Categories/Family for anti-GPR65 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
psychosine receptor
NCBI Official Synonym Full Names
G protein-coupled receptor 65
NCBI Official Symbol
GPR65
NCBI Official Synonym Symbols
TDAG8; hTDAG8
NCBI Protein Information
psychosine receptor
UniProt Protein Name
Psychosine receptor
UniProt Gene Name
GPR65
UniProt Synonym Gene Names
TDAG8
UniProt Entry Name
PSYR_HUMAN
Similar Products
Product Notes
The GPR65 gpr65 (Catalog #AAA201305) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPR65 antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPR65 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GPR65 gpr65 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPR65, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.