WB (Western Blot)
(WB Suggested Anti-GPT Antibody Titration: 5.0ug/mlPositive Control: Fetal liver cell lysate)
Rabbit GPT Polyclonal Antibody | anti-GPT antibody
GPT antibody - N-terminal region
Gene Names
GPT; AAT1; ALT1; GPT1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
GPT, Antibody; GPT antibody - N-terminal region; anti-GPT antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPIT
Sequence Length
496
Applicable Applications for anti-GPT antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GPT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-GPT Antibody Titration: 5.0ug/mlPositive Control: Fetal liver cell lysate)
WB (Western Blot)
(WB Suggested Anti-GPT Antibody Titration: 5.0ug/mlPositive Control: Fetal liver cell lysate)
IHC (Immunohistochemistry)
(Human Muscle)
IHC (Immunohistochemistry)
(Human Muscle)
Related Product Information for anti-GPT antibody
This is a rabbit polyclonal antibody against GPT. It was validated on Western Blot and immunohistochemistry
Target Description: GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
Target Description: GPT participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles.
Product Categories/Family for anti-GPT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
alanine aminotransferase 1
NCBI Official Synonym Full Names
glutamic--pyruvic transaminase
NCBI Official Symbol
GPT
NCBI Official Synonym Symbols
AAT1; ALT1; GPT1
NCBI Protein Information
alanine aminotransferase 1
UniProt Protein Name
Alanine aminotransferase 1
UniProt Gene Name
GPT
UniProt Synonym Gene Names
AAT1; GPT1; ALT1; GPT 1
UniProt Entry Name
ALAT1_HUMAN
Similar Products
Product Notes
The GPT gpt (Catalog #AAA199600) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPT antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GPT gpt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRVEYAVRGP IVQRALELEQ ELRQGVKKPF TEVIRANIGD AQAMGQRPIT. It is sometimes possible for the material contained within the vial of "GPT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.