<
WB (Western Blot)
(Host: MouseTarget Name: GRB2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Rabbit GRB2 Polyclonal Antibody | anti-GRB2 antibody
GRB2 antibody - N-terminal region
Gene Names
GRB2; ASH; Grb3-3; MST084; NCKAP2; MSTP084; EGFRBP-GRB2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GRB2, Antibody; GRB2 antibody - N-terminal region; anti-GRB2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIE
Sequence Length
217
Applicable Applications for anti-GRB2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: MouseTarget Name: GRB2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: GRB2Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
WB (Western Blot)
(GRB2 antibody - N-terminal region validated by WB using 721_B cell Lysate at 1ug/ml.GRB2 is supported by BioGPS gene expression data to be expressed in 721_B)
WB (Western Blot)
(GRB2 antibody - N-terminal region validated by WB using 721_B cell Lysate at 1ug/ml.GRB2 is supported by BioGPS gene expression data to be expressed in 721_B)
WB (Western Blot)
(GRB2 antibody - N-terminal region validated by WB using 1. and 2. Human Cystic Fibrosis Bronchial Epithelial Cells (35ug) Primary Dilution: 1:500Secondary Anitbody: goat anti-rabbit-HRPSecondary Dilution: 1:5000Image Submitted By: Dr. Haouaria BalghiMcGill University)
WB (Western Blot)
(GRB2 antibody - N-terminal region validated by WB using 1. and 2. Human Cystic Fibrosis Bronchial Epithelial Cells (35ug) Primary Dilution: 1:500Secondary Anitbody: goat anti-rabbit-HRPSecondary Dilution: 1:5000Image Submitted By: Dr. Haouaria BalghiMcGill University)
WB (Western Blot)
(Sample Type: mouse brainSample Type:2. mouse brain extracts (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)
WB (Western Blot)
(Sample Type: mouse brainSample Type:2. mouse brain extracts (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)
IHC (Immunohistochemistry)
(Rabbit Anti-GRB2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-GRB2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-GRB2 antibody
This is a rabbit polyclonal antibody against GRB2. It was validated on Western Blot
Target Description: The protein encoded by this gene binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Its two SH3 domains direct complex formation with proline-rich regions of other proteins, and its SH2 domain binds tyrosine phosphorylated sequences. This gene is similar to the Sem5 gene of C.elegans, which is involved in the signal transduction pathway. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Target Description: The protein encoded by this gene binds the epidermal growth factor receptor and contains one SH2 domain and two SH3 domains. Its two SH3 domains direct complex formation with proline-rich regions of other proteins, and its SH2 domain binds tyrosine phosphorylated sequences. This gene is similar to the Sem5 gene of C.elegans, which is involved in the signal transduction pathway. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-GRB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
growth factor receptor-bound protein 2 isoform 1
NCBI Official Synonym Full Names
growth factor receptor bound protein 2
NCBI Official Symbol
GRB2
NCBI Official Synonym Symbols
ASH; Grb3-3; MST084; NCKAP2; MSTP084; EGFRBP-GRB2
NCBI Protein Information
growth factor receptor-bound protein 2
UniProt Protein Name
Growth factor receptor-bound protein 2
UniProt Gene Name
GRB2
UniProt Synonym Gene Names
ASH
UniProt Entry Name
GRB2_HUMAN
Similar Products
Product Notes
The GRB2 grb2 (Catalog #AAA200823) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRB2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GRB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GRB2 grb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKYDFKATAD DELSFKRGDI LKVLNEECDQ NWYKAELNGK DGFIPKNYIE. It is sometimes possible for the material contained within the vial of "GRB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.