Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198490_WB13.jpg WB (Western Blot) (WB Suggested Anti-GRHL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit GRHL3 Polyclonal Antibody | anti-GRHL3 antibody

GRHL3 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
GRHL3; SOM; VWS2; TFCP2L4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GRHL3, Antibody; GRHL3 antibody - C-terminal region; anti-GRHL3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN
Sequence Length
509
Applicable Applications for anti-GRHL3 antibody
ChIP (Chromatin immunoprecipitation), WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GRHL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GRHL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

product-image-AAA198490_WB13.jpg WB (Western Blot) (WB Suggested Anti-GRHL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

IHC (Immunohistochemistry)

(Placenta)

product-image-AAA198490_IHC15.jpg IHC (Immunohistochemistry) (Placenta)
Related Product Information for anti-GRHL3 antibody
This is a rabbit polyclonal antibody against GRHL3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GRHL3 is a member of the grainyhead family of transcription factors. GRHL3 interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with leader-binding protein 32 (LBP-32) and brother of mammalian grainyhead (BOM), and may function as a transcription factor during development. Multiple transcript variants encoding distinct isoforms have been identified for this gene. Additional transcript variants have been described, but their biological nature has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
grainyhead-like protein 3 homolog isoform 3
NCBI Official Synonym Full Names
grainyhead like transcription factor 3
NCBI Official Symbol
GRHL3
NCBI Official Synonym Symbols
SOM; VWS2; TFCP2L4
NCBI Protein Information
grainyhead-like protein 3 homolog
UniProt Protein Name
Grainyhead-like protein 3 homolog
UniProt Gene Name
GRHL3
UniProt Synonym Gene Names
SOM; TFCP2L4
UniProt Entry Name
GRHL3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GRHL3 grhl3 (Catalog #AAA198490) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRHL3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRHL3 can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GRHL3 grhl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEVFDALMLK TPDLKGLRNA ISEKYGFPEE NIYKVYKKCK RGILVNMDNN. It is sometimes possible for the material contained within the vial of "GRHL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.