WB (Western Blot)
(WB Suggested Anti-GRIA2 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Rabbit GRIA2 Polyclonal Antibody | anti-GRIA2 antibody
GRIA2 antibody - N-terminal region
Gene Names
GRIA2; GLUR2; GLURB; GluA2; HBGR2; GluR-K2
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
GRIA2, Antibody; GRIA2 antibody - N-terminal region; anti-GRIA2 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTIT
Sequence Length
883
Applicable Applications for anti-GRIA2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-GRIA2 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-GRIA2 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
IHC (Immunohiostchemistry)
(Primary AntibodiesBrain slices were incubated overnight in a solution of PBST (0.2%) + 10% Normal GOAT serum + a monoclonal mouse anti-Parvalbumin antibody (1:2000)+ rabbit anti-GRIA2 (1ug/mL)and gently shaken overnight at 4 C.Secondary AntibodiesSamples were washed 6x in PBS (10 min each at RT) and exposed to the following secondary antibodies o/n at 4 C: PBST (0.3%) + 10% normal goat serum + anti-mouse Alexa 488 (1:1000) + Anti-rabbit Alexa 555 (1:1000) for two hours. Samples were washed 6x in PBST mounted. Images acquired with a confocal microscope at 63X.)
IHC (Immunohiostchemistry)
(Primary AntibodiesBrain slices were incubated overnight in a solution of PBST (0.2%) + 10% Normal GOAT serum + a monoclonal mouse anti-Parvalbumin antibody (1:2000)+ rabbit anti-GRIA2 (1ug/mL)and gently shaken overnight at 4 C.Secondary AntibodiesSamples were washed 6x in PBS (10 min each at RT) and exposed to the following secondary antibodies o/n at 4 C: PBST (0.3%) + 10% normal goat serum + anti-mouse Alexa 488 (1:1000) + Anti-rabbit Alexa 555 (1:1000) for two hours. Samples were washed 6x in PBST mounted. Images acquired with a confocal microscope at 63X.)
IHC (Immunohistochemistry)
(Sample Type: Mouse GutApplication: ImmunohistochemistrySpecies+tissue/cell type: Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStopHow many ug'sof tissue/cell lysate run on the gel: 11 m Mouse Gut TissuePrimary antibody dilution: 1:50Secondary antibody: Goat anti-rabbit-cy3Secondary antibody dilution: 1:1500)
IHC (Immunohistochemistry)
(Sample Type: Mouse GutApplication: ImmunohistochemistrySpecies+tissue/cell type: Mouse Gut Tissue TgWnt1-Cre/+ Ednrbflex3/+ Rosa26YFPStop/YFPStopHow many ug'sof tissue/cell lysate run on the gel: 11 m Mouse Gut TissuePrimary antibody dilution: 1:50Secondary antibody: Goat anti-rabbit-cy3Secondary antibody dilution: 1:1500)
Related Product Information for anti-GRIA2 antibody
This is a rabbit polyclonal antibody against GRIA2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GRIA2 is one of the glutamate receptors, which are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with mul
Target Description: GRIA2 is one of the glutamate receptors, which are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with mul
Product Categories/Family for anti-GRIA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
99kDa
NCBI Official Full Name
glutamate receptor 2 isoform 1
NCBI Official Synonym Full Names
glutamate ionotropic receptor AMPA type subunit 2
NCBI Official Symbol
GRIA2
NCBI Official Synonym Symbols
GLUR2; GLURB; GluA2; HBGR2; GluR-K2
NCBI Protein Information
glutamate receptor 2
UniProt Protein Name
Glutamate receptor 2
UniProt Gene Name
GRIA2
UniProt Synonym Gene Names
GLUR2; GluR-2; GluA2
UniProt Entry Name
GRIA2_HUMAN
Similar Products
Product Notes
The GRIA2 gria2 (Catalog #AAA201716) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRIA2 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GRIA2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GRIA2 gria2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STSEFRLTPH IDNLEVANSF AVTNAFCSQF SRGVYAIFGF YDKKSVNTIT. It is sometimes possible for the material contained within the vial of "GRIA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.