Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282372_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using GRID2 antibody (AAA282372) at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit GRID2 Polyclonal Antibody | anti-GRID2 antibody

GRID2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
GRID2; GluD2
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
GRID2, Antibody; GRID2 Rabbit pAb; GluD2; SCAR18; anti-GRID2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
IDLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
Applicable Applications for anti-GRID2 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
Mouse brian
Cellular Location
dendritic spine, glutamatergic synapse, parallel fiber to Purkinje cell synapse, plasma membrane, postsynaptic density membrane, postsynaptic membrane, synapse
Research Area
Neuroscience
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 900-1007 of human GRID2 (NP_001501.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using GRID2 antibody (AAA282372) at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282372_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using GRID2 antibody (AAA282372) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using GRID2 antibody (AAA282372) at dilution of 1:100. Blue: DAPI for nuclear staining)

product-image-AAA282372_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using GRID2 antibody (AAA282372) at dilution of 1:100. Blue: DAPI for nuclear staining)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using GRID2 antibody (AAA282372) at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282372_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using GRID2 antibody (AAA282372) at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of Mouse brian, using GRID2 antibody (AAA282372) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)

product-image-AAA282372_WB15.jpg WB (Western Blot) (Western blot analysis of Mouse brian, using GRID2 antibody (AAA282372) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.)
Related Product Information for anti-GRID2 antibody
The protein encoded by this gene is a member of the family of ionotropic glutamate receptors which are the predominant excitatory neurotransmitter receptors in the mammalian brain. The encoded protein is a multi-pass membrane protein that is expressed selectively in cerebellar Purkinje cells. A point mutation in the mouse ortholog, associated with the phenotype named 'lurcher', in the heterozygous state leads to ataxia resulting from selective, cell-autonomous apoptosis of cerebellar Purkinje cells during postnatal development. Mice homozygous for this mutation die shortly after birth from massive loss of mid- and hindbrain neurons during late embryogenesis. This protein also plays a role in synapse organization between parallel fibers and Purkinje cells. Alternate splicing results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause cerebellar ataxia in humans.
Product Categories/Family for anti-GRID2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
113,356 Da
NCBI Official Full Name
glutamate receptor ionotropic, delta-2
NCBI Official Synonym Full Names
glutamate receptor, ionotropic, delta 2
NCBI Official Symbol
GRID2
NCBI Official Synonym Symbols
GluD2
NCBI Protein Information
glutamate receptor ionotropic, delta-2; GluR-delta-2; gluR delta-2 subunit; glutamate receptor delta-2 subunit
UniProt Protein Name
Glutamate receptor ionotropic, delta-2
UniProt Gene Name
GRID2
UniProt Synonym Gene Names
GLURD2; GluD2
UniProt Entry Name
GRID2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GRID2 grid2 (Catalog #AAA282372) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRID2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRID2 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the GRID2 grid2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IDLTPLDIDT LPTRQALEQI SDFRNTHITT TTFIPEQIQT LSRTLSAKAA SGFTFGNVPE HRTGPFRHRA PNGGFFRSPI KTMSSIPYQP TPTLGLNLGN DPDRGTSI. It is sometimes possible for the material contained within the vial of "GRID2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.