GRK5 Polyclonal Antibody | anti-GRK5 antibody

Anti-GRK5 Antibody

Cat. Num. AAA46467

• Gene Names: GRK5; GPRK5
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: GRK5, Antibody; Anti-GRK5 Antibody; G protein-coupled receptor kinase 5; FLJ39780; FP2025; G protein coupled receptor kinase 5; G protein coupled receptor kinase GRK5; G protein-coupled receptor kinase GRK5; GPRK5; GRK-pan; GRK5; GRK5_HUMAN; Pan-GRK; anti-GRK5 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 590

• Applicable Applications for anti-GRK5 antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human GRK5 (393-429aa KREEVDRRVLETEEVYSHKFSEEAKSICKMLLTKDAK), different from the related mouse and rat sequences by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Applications: Western BlotSample: Rat endothelial cellsDetection: Kodak Image Station 4000R Pro;Thermo Scientific West Femto Maximum Sensitivity Substrate"After using this antibody for western blot to analyze rat endothelial cells' protein, I found AAA46467 Anti-GRK5 antibody worked very well. The blot of 68 Kda can be seen, however, we can see another 3 blots at least. In a word, Anti GRK5 (PB 9708) is useful and good. The blot of 68 Kda can be detected.")

IHC (Immunohistochemistry)

(Anti- GRK5 Picoband antibody, AAA46467,IHC(P)IHC(P): Human Placenta Tissue)

IHC (Immunohistochemisry)

(Anti- GRK5 Picoband antibody, AAA46467,IHC(P)IHC(P): Mouse Lung Tissue)

IHC (Immunohiostchemistry)

(Anti- GRK5 Picoband antibody, AAA46467,IHC(P)IHC(P): Rat Cardiac Muscle Tissue)

WB (Western Blot)

(Anti- GRK5 Picoband antibody, AAA46467, Western blottingAll lanes: Anti GRK5 (AAA46467) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: SMMC Whole Cell Lysate at 40ugPredicted bind size: 68KDObserved bind size: 68KD)

Related Product Information for anti-GRK5 antibody

Description: Rabbit IgG polyclonal antibody for G protein-coupled receptor kinase 5(GRK5) detection. Tested with WB, IHC-P in Human;Rat;Mouse.

Background: G protein-coupled receptor kinase 5 is an enzyme that in humans is encoded by the GRK5 gene. It is mapped to 10q26.11. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

References

1. "Entrez Gene: GRK5 G protein-coupled receptor kinase 5". 2. Bullrich F, Druck T, Kunapuli P, et al. (1995). "Chromosomal mapping of the genes GPRK5 and GPRK6 encoding G protein-coupled receptor kinases GRK5 and GRK6.". Cytogenet. Cell Genet. 70 (3-4): 250-4. 3. Kunapuli P, Benovic JL (Jul 1993). "Cloning and expression of GRK5: a member of the G protein-coupled receptor kinase family". Proc Natl Acad Sci U S A 90 (12): 5588-92.

NCBI and Uniprot Product Information

• NCBI GI #: 4885349
• NCBI GeneID: 2869
• NCBI Accession #: NP_005299.1
• NCBI GenBank Nucleotide #: NM_005308.2
• UniProt Accession #: P34947; Q5T059; D3DRD0
• Molecular Weight: 67,787 Da
• NCBI Official Full Name: G protein-coupled receptor kinase 5
• NCBI Official Synonym Full Names: G protein-coupled receptor kinase 5
• NCBI Official Symbol: GRK5
• NCBI Official Synonym Symbols: GPRK5
• NCBI Protein Information: G protein-coupled receptor kinase 5
• UniProt Protein Name: G protein-coupled receptor kinase 5
• UniProt Gene Name: GRK5
• UniProt Synonym Gene Names: GPRK5
• UniProt Entry Name: GRK5_HUMAN