WB (Western Blot)
(WB Suggested Anti-DFNA5 Antibody Titration: 1.25 ug/mlPositive Control: HepG2 cell lysateDFNA5 is supported by BioGPS gene expression data to be expressed in HepG2)
Rabbit GSDME Polyclonal Antibody | anti-GSDME antibody
GSDME Antibody - C-terminal region
Gene Names
GSDME; DFNA5; ICERE-1
Reactivity
Cow, Dog, Guinea Pig, Human, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
GSDME, Antibody; GSDME Antibody - C-terminal region; anti-GSDME antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR
Sequence Length
437
Applicable Applications for anti-GSDME antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 85%; Dog: 77%; Guinea Pig: 83%; Human: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DFNA5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-DFNA5 Antibody Titration: 1.25 ug/mlPositive Control: HepG2 cell lysateDFNA5 is supported by BioGPS gene expression data to be expressed in HepG2)
WB (Western Blot)
(WB Suggested Anti-DFNA5 Antibody Titration: 1.25 ug/mlPositive Control: HepG2 cell lysateDFNA5 is supported by BioGPS gene expression data to be expressed in HepG2)
IHC (Immunohistochemistry)
(Human kidney)
IHC (Immunohistochemistry)
(Human kidney)
Related Product Information for anti-GSDME antibody
This is a rabbit polyclonal antibody against DFNA5. It was validated on Western Blot and immunohistochemistry
Target Description: Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene.
Target Description: Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-GSDME antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47kDa
NCBI Official Full Name
DFNA5 protein, partial
NCBI Official Synonym Full Names
gasdermin E
NCBI Official Symbol
GSDME
NCBI Official Synonym Symbols
DFNA5; ICERE-1
NCBI Protein Information
gasdermin-E
Similar Products
Product Notes
The GSDME (Catalog #AAA199662) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GSDME Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GSDME can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GSDME for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AALLGTCCKL QIIPTLCHLL RALSDDGVSD LEDPTLTPLK DTERFGIVQR. It is sometimes possible for the material contained within the vial of "GSDME, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.