Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200132_WB13.jpg WB (Western Blot) (WB Suggested Anti-H6PD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateH6PD is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit H6PD Polyclonal Antibody | anti-H6PD antibody

H6PD antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
H6PD; GDH; G6PDH; CORTRD1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
H6PD, Antibody; H6PD antibody - N-terminal region; anti-H6PD antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW
Sequence Length
791
Applicable Applications for anti-H6PD antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human H6PD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-H6PD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateH6PD is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA200132_WB13.jpg WB (Western Blot) (WB Suggested Anti-H6PD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateH6PD is supported by BioGPS gene expression data to be expressed in 721_B)

IHC (Immunohistochemistry)

(Rabbit Anti-H6PD AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA200132_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-H6PD AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasmic in alveolar type I cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-H6PD antibody
This is a rabbit polyclonal antibody against H6PD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form, encoded by this gene, is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-H6PD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
GDH/6PGL endoplasmic bifunctional protein isoform 2
NCBI Official Synonym Full Names
hexose-6-phosphate dehydrogenase/glucose 1-dehydrogenase
NCBI Official Symbol
H6PD
NCBI Official Synonym Symbols
GDH; G6PDH; CORTRD1
NCBI Protein Information
GDH/6PGL endoplasmic bifunctional protein
UniProt Protein Name
GDH/6PGL endoplasmic bifunctional protein
UniProt Gene Name
H6PD
UniProt Synonym Gene Names
GDH; 6PGL
UniProt Entry Name
G6PE_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The H6PD h6pd (Catalog #AAA200132) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The H6PD antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's H6PD can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the H6PD h6pd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HFSAQQLATE LGTFFQEEEM YRVDHYLGKQ AVAQILPFRD QNRKALDGLW. It is sometimes possible for the material contained within the vial of "H6PD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.