Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199076_WB13.jpg WB (Western Blot) (WB Suggested Anti-HBZ Antibody Titration: 1.25ug/mlPositive Control: K562 cell lysateHBZ is supported by BioGPS gene expression data to be expressed in K562)

Rabbit HBZ Polyclonal Antibody | anti-HBZ antibody

HBZ antibody - N-terminal region

Gene Names
HBZ; HBZ1; HBZ-T1
Reactivity
Cow, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
HBZ, Antibody; HBZ antibody - N-terminal region; anti-HBZ antibody
Ordering
Host
Rabbit
Reactivity
Cow, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGA
Sequence Length
142
Applicable Applications for anti-HBZ antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Goat: 93%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 92%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HBZ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HBZ Antibody Titration: 1.25ug/mlPositive Control: K562 cell lysateHBZ is supported by BioGPS gene expression data to be expressed in K562)

product-image-AAA199076_WB13.jpg WB (Western Blot) (WB Suggested Anti-HBZ Antibody Titration: 1.25ug/mlPositive Control: K562 cell lysateHBZ is supported by BioGPS gene expression data to be expressed in K562)

IHC (Immunohistochemistry)

(Rabbit Anti-HBZ AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HemopoieticAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA199076_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-HBZ AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HemopoieticAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-HBZ antibody
This is a rabbit polyclonal antibody against HBZ. It was validated on Western Blot and immunohistochemistry

Target Description: Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'.Zeta-globin (HBZ ) is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that involves 4 functional genes and 3 nonfunctional pseudogenes. The order of genes is: 5'-zeta -- pseudozeta -- pseudoalpha2 -- pseudoalpha1 -- alpha2 -- alph1 -- theta1-3'.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
hemoglobin subunit zeta
NCBI Official Synonym Full Names
hemoglobin subunit zeta
NCBI Official Symbol
HBZ
NCBI Official Synonym Symbols
HBZ1; HBZ-T1
NCBI Protein Information
hemoglobin subunit zeta
UniProt Protein Name
Hemoglobin subunit zeta
UniProt Gene Name
HBZ
UniProt Synonym Gene Names
HBZ2
UniProt Entry Name
HBAZ_HUMAN

Similar Products

Product Notes

The HBZ hbz (Catalog #AAA199076) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HBZ antibody - N-terminal region reacts with Cow, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HBZ can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HBZ hbz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERLFLSHPQT KTYFPHFDLH PGSAQLRAHG SKVVAAVGDA VKSIDDIGGA. It is sometimes possible for the material contained within the vial of "HBZ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.