Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198355_WB8.jpg WB (Western Blot) (WB Suggested Anti-HCFC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)

Rabbit HCFC1 Polyclonal Antibody | anti-HCFC1 antibody

HCFC1 antibody - middle region

Gene Names
HCFC1; CFF; HCF; HCF1; HFC1; MRX3; VCAF; HCF-1; PPP1R89
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HCFC1, Antibody; HCFC1 antibody - middle region; anti-HCFC1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADG
Sequence Length
2035
Applicable Applications for anti-HCFC1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HCFC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HCFC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)

product-image-AAA198355_WB8.jpg WB (Western Blot) (WB Suggested Anti-HCFC1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Stomach)

WB (Western Blot)

(Lanes:Lane1: HIS-HCFC1 16-363aa (42kD) transformed bacteria lysateLane2: GFP-HCFC1 363-2002aa (73kD) transformed bacteria lysate elution samplePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit AlexaFluor 680Secondary Antibody Dilution:1:10000Gene Name:HCFC1Submitted by:Anonymous)

product-image-AAA198355_WB10.jpg WB (Western Blot) (Lanes:Lane1: HIS-HCFC1 16-363aa (42kD) transformed bacteria lysateLane2: GFP-HCFC1 363-2002aa (73kD) transformed bacteria lysate elution samplePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit AlexaFluor 680Secondary Antibody Dilution:1:10000Gene Name:HCFC1Submitted by:Anonymous)

WB (Western Blot)

(Hum. Fetal Liver)

product-image-AAA198355_WB11.jpg WB (Western Blot) (Hum. Fetal Liver)

WB (Western Blot)

(Hum. Fetal Heart)

product-image-AAA198355_WB13.jpg WB (Western Blot) (Hum. Fetal Heart)

WB (Western Blot)

(Host: RabbitTarget Name: HCFC1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198355_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: HCFC1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-HCFC1 antibody
This is a rabbit polyclonal antibody against HCFC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HCFC1 is a member of the host cell factor family with five Kelch repeats, a fibronectin-like motif, and six HCF repeats, each of which contains a highly specific cleavage signal. This nuclear coactivator is proteolytically cleaved at one of the six possib

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
209kDa
NCBI Official Full Name
host cell factor 1
NCBI Official Synonym Full Names
host cell factor C1
NCBI Official Symbol
HCFC1
NCBI Official Synonym Symbols
CFF; HCF; HCF1; HFC1; MRX3; VCAF; HCF-1; PPP1R89
NCBI Protein Information
host cell factor 1
UniProt Protein Name
Host cell factor 1
UniProt Gene Name
HCFC1
UniProt Synonym Gene Names
HCF1; HFC1; HCF; HCF-1
UniProt Entry Name
HCFC1_HUMAN

Similar Products

Product Notes

The HCFC1 hcfc1 (Catalog #AAA198355) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HCFC1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HCFC1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HCFC1 hcfc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARNEKGYGPA TQVRWLQETS KDSSGTKPAN KRPMSSPEMK SAPKKSKADG. It is sometimes possible for the material contained within the vial of "HCFC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.