Rabbit anti-Human HDAC3 Polyclonal Antibody | anti-HDAC3 antibody
HDAC3 Antibody - C-terminal region
Gene Names
HDAC3; HD3; RPD3; KDAC3; RPD3-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HDAC3, Antibody; HDAC3 Antibody - C-terminal region; anti-HDAC3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Sequence Length
428
Applicable Applications for anti-HDAC3 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human HDAC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-HDAC3 antibody
This is a rabbit polyclonal antibody against HDAC3. It was validated on Western Blot
Target Description: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
Target Description: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.
Product Categories/Family for anti-HDAC3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
histone deacetylase 3 isoform 2
NCBI Official Synonym Full Names
histone deacetylase 3
NCBI Official Symbol
HDAC3
NCBI Official Synonym Symbols
HD3; RPD3; KDAC3; RPD3-2
NCBI Protein Information
histone deacetylase 3
UniProt Protein Name
Histone deacetylase 3
UniProt Gene Name
HDAC3
UniProt Synonym Gene Names
HD3
UniProt Entry Name
HDAC3_HUMAN
Similar Products
Product Notes
The HDAC3 hdac3 (Catalog #AAA201517) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HDAC3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HDAC3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HDAC3 hdac3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVPADLLTYD RTDEADAEER GPEENYSRPE APNEFYDGDH DNDKESDVEI. It is sometimes possible for the material contained within the vial of "HDAC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
