Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197174_WB10.jpg WB (Western Blot) (WB Suggested Anti-HDAC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that HDAC6 is expressed in HEK293T)

Rabbit HDAC6 Polyclonal Antibody | anti-HDAC6 antibody

HDAC6 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HDAC6; HD6; JM21; CPBHM; PPP1R90
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity Purified
Synonyms
HDAC6, Antibody; HDAC6 antibody - N-terminal region; anti-HDAC6 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ
Sequence Length
1215
Applicable Applications for anti-HDAC6 antibody
IHC (Immunohistochemistry), ChIP (Chromatin immunoprecipitation)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HDAC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HDAC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that HDAC6 is expressed in HEK293T)

product-image-AAA197174_WB10.jpg WB (Western Blot) (WB Suggested Anti-HDAC6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that HDAC6 is expressed in HEK293T)

IHC (Immunohistochemisry)

(Rabbit Anti-HDAC6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Kidney TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA197174_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-HDAC6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Kidney TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohiostchemistry)

(Rabbit Anti-HDAC6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Cytoplasmic,NuclearPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA197174_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-HDAC6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Cytoplasmic,NuclearPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

ChIP (Chromatin Immunoprecipitation)

(Chromatin Immunoprecipitation (ChIP) Using HDAC6 antibody - N-terminal region and HCT116 Cells)

product-image-AAA197174_CHIP15.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin Immunoprecipitation (ChIP) Using HDAC6 antibody - N-terminal region and HCT116 Cells)
Related Product Information for anti-HDAC6 antibody
This is a rabbit polyclonal antibody against HDAC6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
131kDa, 17 kD
NCBI Official Full Name
HDAC6 protein
NCBI Official Synonym Full Names
histone deacetylase 6
NCBI Official Symbol
HDAC6
NCBI Official Synonym Symbols
HD6; JM21; CPBHM; PPP1R90
NCBI Protein Information
histone deacetylase 6
UniProt Protein Name
Histone deacetylase 6
UniProt Gene Name
HDAC6
UniProt Synonym Gene Names
KIAA0901; HD6
UniProt Entry Name
HDAC6_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HDAC6 hdac6 (Catalog #AAA197174) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HDAC6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HDAC6 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), ChIP (Chromatin immunoprecipitation). Researchers should empirically determine the suitability of the HDAC6 hdac6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGLQGMDLNL EAEALAGTGL VLDEQLNEFH CLWDDSFPEG PERLHAIKEQ. It is sometimes possible for the material contained within the vial of "HDAC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.