Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28414_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 using Heme Oxygenase 1 (HO-1/HMOX1) antibody at dilution of 1 : 50 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit Heme Oxygenase 1 (HO-1/HMOX1) Polyclonal Antibody | anti-HO-1/HMOX1 antibody

[KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
NR1D2; RVR; BD73; EAR-1R
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
Heme Oxygenase 1 (HO-1/HMOX1), Antibody; [KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb; HMOX1; HMOX1D; HO-1; HSP32; bK286B10; heme oxygenase 1; anti-HO-1/HMOX1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
ALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
Applicable Applications for anti-HO-1/HMOX1 antibody
WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry)
Application Notes
WB: 1:500-1:2000
IF/ICC: 1:50-1:200
Positive Samples
HeLa, HepG2
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1).
Cellular Location
Cytoplasmic side, Endoplasmic reticulum membrane, Microsome, Peripheral membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH-3T3 using Heme Oxygenase 1 (HO-1/HMOX1) antibody at dilution of 1 : 50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28414_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH-3T3 using Heme Oxygenase 1 (HO-1/HMOX1) antibody at dilution of 1 : 50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HepG2 using Heme Oxygenase 1 (HO-1/HMOX1) antibody at dilution of 1 : 50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28414_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HepG2 using Heme Oxygenase 1 (HO-1/HMOX1) antibody at dilution of 1 : 50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 using Heme Oxygenase 1 (HO-1/HMOX1) antibody at dilution of 1 : 50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28414_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 using Heme Oxygenase 1 (HO-1/HMOX1) antibody at dilution of 1 : 50 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts from wild type (WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockout (KO) HeLa cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

product-image-AAA28414_WB4.jpg WB (Western Blot) (Western blot analysis of extracts from wild type (WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockout (KO) HeLa cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of HepG2 cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

product-image-AAA28414_WB3.jpg WB (Western Blot) (Western blot analysis of extracts of HepG2 cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA28414_WB2.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of extracts of HeLa cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA28414_WB.jpg WB (Western Blot) (Western blot analysis of extracts of HeLa cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-HO-1/HMOX1 antibody
Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,625 Da
NCBI Official Full Name
nuclear receptor subfamily 1 group D member 2 isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 1, group D, member 2
NCBI Official Symbol
NR1D2
NCBI Official Synonym Symbols
RVR; BD73; EAR-1R
NCBI Protein Information
nuclear receptor subfamily 1 group D member 2; rev-erb-beta; rev-erb alpha-related receptor; rev-erba-alpha-related receptor; V-erbA-related protein 1-related; orphan nuclear hormone receptor BD73; nuclear receptor Rev-ErbA beta variant 1; nuclear recepto
UniProt Protein Name
Nuclear receptor subfamily 1 group D member 2
UniProt Gene Name
NR1D2
UniProt Synonym Gene Names
RVR; EAR-1R
UniProt Entry Name
NR1D2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HO-1/HMOX1 nr1d2 (Catalog #AAA28414) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Heme Oxygenase 1 (HO-1/HMOX1) can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry). WB: 1:500-1:2000 IF/ICC: 1:50-1:200. Researchers should empirically determine the suitability of the HO-1/HMOX1 nr1d2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ALPAQEQLRP KPQLEQENIK SSSPPSSDFA KEEVIGMVTR AHKDTFMYNQ EQQENSAESM QPQRGERIPK NMEQYNLNHD H. It is sometimes possible for the material contained within the vial of "Heme Oxygenase 1 (HO-1/HMOX1), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.