Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46548_WB15.jpg WB (Western Blot) (Anti- Heparanase 1 Picoband antibody, AAA46548, Western blottingAll lanes: Anti Heparanase 1 (AAA46548) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Human Placenta Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 61KDObserved bind size: 61KD)

anti-Human, Rat Heparanase 1 Polyclonal Antibody | anti-HPSE antibody

Anti-Heparanase 1 Antibody

Average rating 0.0
No ratings yet
Gene Names
HPSE; HPA; HPA1; HPR1; HSE1; HPSE1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Heparanase 1, Antibody; Anti-Heparanase 1 Antibody; Heparanase; Endo glucoronidase; Endo-glucoronidase; HEP; Heparanase 50 kDa subunit; Heparanase-1; Heparanase1; Hpa 1; HPA; Hpa1; HPR 1; HPR1; HPSE 1; HPSE; HPSE_HUMAN; HPSE1; HSE 1; HSE1 antibody; heparanase; anti-HPSE antibody
Ordering
Reactivity
Human, Rat
Clonality
Polyclonal
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
543
Applicable Applications for anti-HPSE antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids.
Ig Type
Rabbit IgG
Reconstitution
0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

WB (Western Blot)

(Anti- Heparanase 1 Picoband antibody, AAA46548, Western blottingAll lanes: Anti Heparanase 1 (AAA46548) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Human Placenta Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 61KDObserved bind size: 61KD)

product-image-AAA46548_WB15.jpg WB (Western Blot) (Anti- Heparanase 1 Picoband antibody, AAA46548, Western blottingAll lanes: Anti Heparanase 1 (AAA46548) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Human Placenta Tissue Lysate at 50ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 61KDObserved bind size: 61KD)
Related Product Information for anti-HPSE antibody
Description: Rabbit IgG polyclonal antibody for Heparanase(HPSE) detection. Tested with WB in Human;Rat.

Background: Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.
References
1. Hulett MD, Freeman C, Hamdorf BJ, Baker RT, Harris MJ, Parish CR (July 1999), "Cloning of mammalian heparanase, an important enzyme in tumor invasion and metastasis", Nature medicine 5 (7): 803-9. 2. Nakajima M, Irimura T, Nicolson GL. (1988), "Heparanases and tumor metastasis", J. Cell. Biochem. 36 (2): 157-167. 3. Toyoshima, M.; Nakajima, M. : Human heparanase: purification, characterization, cloning, and expression. J. Biol. Chem. 274: 24153-24160, 1999. 4. Vlodavsky I, Friedmann Y, Elkin M, Aingorn H, Atzmon R, Ishai-Michaeli R, Bitan M, Pappo O, Peretz T, Michal I, Spector L, Pecker I (July 1999), "Mammalian heparanase: gene cloning, expression and function in tumor progression and metastasis", Nature medicine 5 (7): 793-802. 5. Vlodavsky I, Goldshmidt O, Zcharia E, et al. (2003), "Mammalian heparanase: involvement in cancer metastasis, angiogenesis and normal development.", Semin. Cancer Biol. 12 (2): 121-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
heparanase isoform 1 preproprotein
NCBI Official Synonym Full Names
heparanase
NCBI Official Symbol
HPSE
NCBI Official Synonym Symbols
HPA; HPA1; HPR1; HSE1; HPSE1
NCBI Protein Information
heparanase
UniProt Protein Name
Heparanase
UniProt Gene Name
HPSE
UniProt Synonym Gene Names
HEP; HPA; HPA1; HPR1; HPSE1; HSE1; Hpa1
UniProt Entry Name
HPSE_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HPSE hpse (Catalog #AAA46548) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Heparanase 1 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Heparanase 1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HPSE hpse for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Heparanase 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.