Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA124746_IHC13.jpg IHC (Immunohiostchemistry) (Hepatitis B Virus was detected in paraffin-embedded sections of human hepatitis B tissues using rabbit anti- Hepatitis B Virus Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Hepatitis B Virus Polyclonal Antibody | anti-S antibody

Anti-Hepatitis B Virus Picoband Antibody

Average rating 0.0
No ratings yet
Reactivity
Human
Predicted Reactivity: Hepatitis Virus
No cross reactivity with other proteins
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified
Synonyms
Hepatitis B Virus, Antibody; Anti-Hepatitis B Virus Picoband Antibody; Large S protein; S; anti-S antibody
Ordering
Host
Rabbit
Reactivity
Human
Predicted Reactivity: Hepatitis Virus
No cross reactivity with other proteins
Clonality
Polyclonal
Purity/Purification
Immunogen affinity purified
Form/Format
Lyophilized
Concentration
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (varies by lot)
Sequence Length
57
Applicable Applications for anti-S antibody
WB (Western Blot), IHC (Immunohistochemistry)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Hepatitis B Virus (4-51aa WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Hepatitis B Virus was detected in paraffin-embedded sections of human hepatitis B tissues using rabbit anti- Hepatitis B Virus Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA124746_IHC13.jpg IHC (Immunohiostchemistry) (Hepatitis B Virus was detected in paraffin-embedded sections of human hepatitis B tissues using rabbit anti- Hepatitis B Virus Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemistry)

(Hepatitis B Virus was detected in paraffin-embedded sections of human liver cancer tissues using rabbit anti- Hepatitis B Virus Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA124746_IHC15.jpg IHC (Immunohistochemistry) (Hepatitis B Virus was detected in paraffin-embedded sections of human liver cancer tissues using rabbit anti- Hepatitis B Virus Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)
Related Product Information for anti-S antibody
Hepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
6374 MW
UniProt Protein Name
Large S protein
UniProt Gene Name
S

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Hepatitis B Virus s (Catalog #AAA124746) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Hepatitis B Virus Picoband Antibody reacts with Human Predicted Reactivity: Hepatitis Virus No cross reactivity with other proteins and may cross-react with other species as described in the data sheet. AAA Biotech's Hepatitis B Virus can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the Hepatitis B Virus s for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hepatitis B Virus, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.