Hex Polyclonal Antibody | anti-Hex antibody
Anti-Hex Antibody
Gene Names
HHEX; HEX; PRH; HMPH; PRHX; HOX11L-PEN
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Hex, Antibody; Anti-Hex Antibody; Hematopoietically-expressed homeobox protein Hhex; Hematopoietically expressed homeobox; Hematopoietically-expressed homeobox protein HHEX; HEX; HHEX; HHEX_HUMAN; HMPH; Homeobox hematopoietically expressed; Homeobox protein HEX; Homeobox protein PRH; HOX11L PEN; PRH; PRHX; Proline rich homeodomain containing transcription factor; OTTHUMP00000206478; OTTHUMP00000206479; OTTHUMP00000206480; OTTHUMP00000206482; OTTHUMP00000207360; USURPIN; Usurpin beta; hematopoietically expressed homeobox; anti-Hex antibody
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
270
Applicable Applications for anti-Hex antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Hex(146-180aa NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ), different from the related mouse sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Related Product Information for anti-Hex antibody
Description: Rabbit IgG polyclonal antibody for Hematopoietically-expressed homeobox protein Hhex(HHEX) detection. Tested with WB in Human;Mouse; Rat.
Background: Hematopoietically-expressed homeobox protein HHEX is a protein that in humans is encoded by the HHEX gene. Homeobox genes are members of a family of transcription factors that regulate tissue development in many different organisms. Hromas et al. (1993) set out to identify homeobox genes that might play a role in hematopoiesis. And using somatic cell hybrid analysis, they mapped the HHEX gene to chromosome 10, where the HOX11 gene is located. Homeobox genes are involved in neoplastic transformation of both epithelial and hemopoietic tissues. The divergent homeobox gene HEX is expressed in the anterior visceral endoderm during early mouse development and in some adult tissues of endodermal origin, including liver and thyroid. D'Elia et al.'s findings suggested that regulation of HEX entry in the nucleus of thyrocytes may represent a critical step during human thyroid tumorigenesis.
Background: Hematopoietically-expressed homeobox protein HHEX is a protein that in humans is encoded by the HHEX gene. Homeobox genes are members of a family of transcription factors that regulate tissue development in many different organisms. Hromas et al. (1993) set out to identify homeobox genes that might play a role in hematopoiesis. And using somatic cell hybrid analysis, they mapped the HHEX gene to chromosome 10, where the HOX11 gene is located. Homeobox genes are involved in neoplastic transformation of both epithelial and hemopoietic tissues. The divergent homeobox gene HEX is expressed in the anterior visceral endoderm during early mouse development and in some adult tissues of endodermal origin, including liver and thyroid. D'Elia et al.'s findings suggested that regulation of HEX entry in the nucleus of thyrocytes may represent a critical step during human thyroid tumorigenesis.
References
1. D'Elia, A. V., Tell, G., Russo, D., Arturi, F., Puglisi, F., Manfioletti, G., Gattei, V., Mack, D. L., Cataldi, P., Filetti, S., Di Loreto, C., Damante, G. Expression and localization of the homeodomain-containing protein HEX in human thyroid tumors. J. Clin. Endocr. Metab. 87: 1376-1383, 2002. 2. Hromas, R., Radich, J., Collins, S. PCR cloning of an orphan homeobox gene (PRH) preferentially expressed in myeloid and liver cells. Biochem. Biophys. Res. Commun. 195: 976-983, 1993.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30,022 Da
NCBI Official Full Name
hematopoietically-expressed homeobox protein HHEX
NCBI Official Synonym Full Names
hematopoietically expressed homeobox
NCBI Official Symbol
HHEX
NCBI Official Synonym Symbols
HEX; PRH; HMPH; PRHX; HOX11L-PEN
NCBI Protein Information
hematopoietically-expressed homeobox protein HHEX
UniProt Protein Name
Hematopoietically-expressed homeobox protein HHEX
UniProt Gene Name
HHEX
UniProt Synonym Gene Names
HEX; PRH; PRHX; Homeobox protein HEX
UniProt Entry Name
HHEX_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Hex hhex (Catalog #AAA46455) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Hex Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hex can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the Hex hhex for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hex, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
