WB (Western Blot)
(Host: RabbitTarget Name: HEY1Sample Type: Fetal Kidney lysatesAntibody Dilution: 0.6ug/ml)
Rabbit HEY1 Polyclonal Antibody | anti-HEY1 antibody
HEY1 Antibody - N-terminal region
Gene Names
HEY1; CHF2; OAF1; HERP2; HESR1; HRT-1; NERP2; hHRT1; BHLHb31
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HEY1, Antibody; HEY1 Antibody - N-terminal region; anti-HEY1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEK
Sequence Length
304
Applicable Applications for anti-HEY1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HEY1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: HEY1Sample Type: Fetal Kidney lysatesAntibody Dilution: 0.6ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: HEY1Sample Type: Fetal Kidney lysatesAntibody Dilution: 0.6ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: HEY1Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: HEY1Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HEY1 antibody
This is a rabbit polyclonal antibody against HEY1. It was validated on Western Blot
Target Description: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.
Target Description: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates.
Product Categories/Family for anti-HEY1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
hairy/enhancer-of-split related with YRPW motif protein 1 isoform a
NCBI Official Synonym Full Names
hes related family bHLH transcription factor with YRPW motif 1
NCBI Official Symbol
HEY1
NCBI Official Synonym Symbols
CHF2; OAF1; HERP2; HESR1; HRT-1; NERP2; hHRT1; BHLHb31
NCBI Protein Information
hairy/enhancer-of-split related with YRPW motif protein 1
UniProt Protein Name
Hairy/enhancer-of-split related with YRPW motif protein 1
UniProt Gene Name
HEY1
UniProt Synonym Gene Names
BHLHB31; CHF2; HERP2; HESR1; HRT1; CHF-2; bHLHb31; HESR-1; HRT-1; hHRT1
UniProt Entry Name
HEY1_HUMAN
Similar Products
Product Notes
The HEY1 hey1 (Catalog #AAA201478) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HEY1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HEY1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HEY1 hey1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSALGSMSPT TSSQILARKR RRGIIEKRRR DRINNSLSEL RRLVPSAFEK. It is sometimes possible for the material contained within the vial of "HEY1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.