Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28284_IP8.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 150ug extracts of MCF7 cells using 3ug HIST3H3 antibody. Western blot was performed from the immunoprecipitate using HIST3H3 antibody at a dilition of 1:500.)

Rabbit HIST3H3 Polyclonal Antibody | anti-HIST3H3 antibody

HIST3H3 Polyclonal Antibody

Gene Names
HIST3H3; H3t; H3.4; H3/g; H3FT
Reactivity
Human, Mouse, Rat, Other (Wide Range)
Applications
Western Blot, Immunohistochemistry, Immunoprecipitation
Purity
Affinity Purification
Synonyms
HIST3H3, Antibody; HIST3H3 Polyclonal Antibody; H3.4; H3/g; H3FT; H3t; anti-HIST3H3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Other (Wide Range)
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Sequence Length
136
Applicable Applications for anti-HIST3H3 antibody
WB (Western Blot), IHC (Immunohistochemistry), IP (Immunoprecipitation)
Application Notes
WB: 1:500 - 1:2000
IHC: 1:50 - 1:200
IP: 1:20 - 1:50
Immunogen
Recombinant protein of human HIST3H3
Immunogen Species
Human
Cellular Location
Chromosome, Nucleus
Positive Samples
Jurkat, A-431, HeLa, Mouse liver, Mouse testis, Rat kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 150ug extracts of MCF7 cells using 3ug HIST3H3 antibody. Western blot was performed from the immunoprecipitate using HIST3H3 antibody at a dilition of 1:500.)

product-image-AAA28284_IP8.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 150ug extracts of MCF7 cells using 3ug HIST3H3 antibody. Western blot was performed from the immunoprecipitate using HIST3H3 antibody at a dilition of 1:500.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse heart using HIST3H3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28284_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse heart using HIST3H3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using HIST3H3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28284_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using HIST3H3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human kidney cancer using HIST3H3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28284_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human kidney cancer using HIST3H3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human oophoroma using HIST3H3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28284_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human oophoroma using HIST3H3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human liver cancer using HIST3H3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28284_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human liver cancer using HIST3H3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat kidney using HIST3H3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA28284_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat kidney using HIST3H3 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using HIST3H3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA28284_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using HIST3H3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-HIST3H3 antibody
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
Product Categories/Family for anti-HIST3H3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 15kDa
Observed: 17kDa
NCBI Official Full Name
histone H3.1t
NCBI Official Synonym Full Names
histone cluster 3 H3
NCBI Official Symbol
HIST3H3
NCBI Official Synonym Symbols
H3t; H3.4; H3/g; H3FT
NCBI Protein Information
histone H3.1t
UniProt Protein Name
Histone H3.1t
UniProt Gene Name
HIST3H3
UniProt Synonym Gene Names
H3FT; H3/t; H3t

Similar Products

Product Notes

The HIST3H3 hist3h3 (Catalog #AAA28284) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIST3H3 Polyclonal Antibody reacts with Human, Mouse, Rat, Other (Wide Range) and may cross-react with other species as described in the data sheet. AAA Biotech's HIST3H3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IP (Immunoprecipitation). WB: 1:500 - 1:2000 IHC: 1:50 - 1:200 IP: 1:20 - 1:50. Researchers should empirically determine the suitability of the HIST3H3 hist3h3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: REIRRYQKST ELLIRKLPFQ RLMREIAQDF KTDLRFQSSA VMALQEACES YLVGLFEDTN LCVIHAKRVT IMPKDIQLAR RIRGERA. It is sometimes possible for the material contained within the vial of "HIST3H3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.