Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281859_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using H2AFV antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit Histone H2AFV Polyclonal Antibody | anti-H2AFV antibody

Histone H2AFV Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
H2AFV; H2AV; H2A.Z-2
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Histone H2AFV, Antibody; Histone H2AFV Rabbit pAb; H2A.Z-2; H2AV; H2AFV; anti-H2AFV antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
Applicable Applications for anti-H2AFV antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human H2AFV (NP_036544.1).
Positive Samples
293T, A-431, Mouse thymus, Mouse spleen, Rat thymus, Rat lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U-2 OS cells using H2AFV antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281859_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U-2 OS cells using H2AFV antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using H2AFV antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281859_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using H2AFV antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using H2AFV antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281859_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using H2AFV antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Rat testis using H2AFV Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281859_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Rat testis using H2AFV Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using H2AFV antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281859_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using H2AFV antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-H2AFV antibody
Background: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq, Oct 2015]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
6,892 Da
NCBI Official Full Name
histone H2A.V isoform 1
NCBI Official Synonym Full Names
H2A histone family, member V
NCBI Official Symbol
H2AFV
NCBI Official Synonym Symbols
H2AV; H2A.Z-2
NCBI Protein Information
histone H2A.V; H2A.F/Z; histone H2A.F/Z; purine-rich binding element protein B
UniProt Protein Name
Histone H2A.V
UniProt Gene Name
H2AFV
UniProt Synonym Gene Names
H2AV

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The H2AFV h2afv (Catalog #AAA281859) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Histone H2AFV Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Histone H2AFV can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the H2AFV h2afv for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGGKAGKDS GKAKAKAVSR SQRAGLQFPV GRIHRHLKTR TTSHGRVGAT AAVYSAAILE YLTAEVLELA GNASKDLKVK RITPRHLQLA IRGDEELDSL IKATIAGGGV IPHIHKSLIG KKGQQKTA. It is sometimes possible for the material contained within the vial of "Histone H2AFV, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.