<
WB (Western Blot)
(WB Suggested Anti-HK2 Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysateHK2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Rabbit HK2 Polyclonal Antibody | anti-HK2 antibody
HK2 antibody - N-terminal region
Gene Names
HK2; HKII; HXK2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HK2, Antibody; HK2 antibody - N-terminal region; anti-HK2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG
Sequence Length
917
Applicable Applications for anti-HK2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-HK2 Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysateHK2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
WB (Western Blot)
(WB Suggested Anti-HK2 Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysateHK2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
WB (Western Blot)
(Lanes:1: 50 ug HEP3B lysate, 2: 50 ug HEP3B lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Gene Name:HK2Submitted by:Received from annonymous)
WB (Western Blot)
(Lanes:1: 50 ug HEP3B lysate, 2: 50 ug HEP3B lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Gene Name:HK2Submitted by:Received from annonymous)
IHC (Immunohiostchemistry)
(Rabbit Anti-HK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohiostchemistry)
(Rabbit Anti-HK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml using anti-HK2 antibody)
IHC (Immunohistochemistry)
(Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml using anti-HK2 antibody)
Related Product Information for anti-HK2 antibody
This is a rabbit polyclonal antibody against HK2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-348 AI278414.1 4-351 349-732 CB160837.1 11-394 c 733-1006 BM912287.1 1-274 c 1007-1333 AI085541.1 1-327 c 1334-1477 AW134604.1 8-151 1478-4058 AF148513.1 1-2581 4059-5498 BC064369.1 2575-4014 5499-5615 BM706373.1 303-419 5616-7109 BC064369.1 4130-5623
Target Description: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. HK2 (hexokinase 2) is the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this protein is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-348 AI278414.1 4-351 349-732 CB160837.1 11-394 c 733-1006 BM912287.1 1-274 c 1007-1333 AI085541.1 1-327 c 1334-1477 AW134604.1 8-151 1478-4058 AF148513.1 1-2581 4059-5498 BC064369.1 2575-4014 5499-5615 BM706373.1 303-419 5616-7109 BC064369.1 4130-5623
Product Categories/Family for anti-HK2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102kDa
NCBI Official Full Name
hexokinase-2
NCBI Official Synonym Full Names
hexokinase 2
NCBI Official Symbol
HK2
NCBI Official Synonym Symbols
HKII; HXK2
NCBI Protein Information
hexokinase-2
UniProt Protein Name
Hexokinase-2
UniProt Gene Name
HK2
UniProt Synonym Gene Names
HK II
UniProt Entry Name
HXK2_HUMAN
Similar Products
Product Notes
The HK2 hk2 (Catalog #AAA200350) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HK2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HK2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HK2 hk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTEHGEFLAL DLGGTNFRVL WVKVTDNGLQ KVEMENQIYA IPEDIMRGSG. It is sometimes possible for the material contained within the vial of "HK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.