WB (Western Blot)
(WB Suggested Anti-HLX1 Antibody Titration: 1ug/mlPositive Control: HepG2 cell lysate)
Rabbit anti-Zebrafish HLX1 Polyclonal Antibody | anti-HLX antibody
HLX1 antibody - middle region
Gene Names
HLX; HB24; HLX1
Reactivity
Zebrafish
Applications
Western Blot, Immunofluorescence
Purity
Protein A purified
Synonyms
HLX1, Antibody; HLX1 antibody - middle region; anti-HLX antibody
Host
Rabbit
Reactivity
Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR
Sequence Length
488
Applicable Applications for anti-HLX antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HLX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-HLX1 Antibody Titration: 1ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-HLX1 Antibody Titration: 1ug/mlPositive Control: HepG2 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: HLX1Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: HLX1Sample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)
IF (Immunofluorescence)
(Sample Type: Xenopus Laevis embryo stage 46 gut tissue Primary Dilution: 1:200)
IF (Immunofluorescence)
(Sample Type: Xenopus Laevis embryo stage 46 gut tissue Primary Dilution: 1:200)
Related Product Information for anti-HLX antibody
This is a rabbit polyclonal antibody against HLX1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: H2.0-like homeo box 1; H2.0 (Drosophilia)-like homeo box-1.
Target Description: H2.0-like homeo box 1; H2.0 (Drosophilia)-like homeo box-1.
Product Categories/Family for anti-HLX antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
H2.0-like homeobox protein
NCBI Official Synonym Full Names
H2.0 like homeobox
NCBI Official Symbol
HLX
NCBI Official Synonym Symbols
HB24; HLX1
NCBI Protein Information
H2.0-like homeobox protein
UniProt Protein Name
H2.0-like homeobox protein
UniProt Gene Name
HLX
UniProt Synonym Gene Names
HLX1
UniProt Entry Name
HLX_HUMAN
Similar Products
Product Notes
The HLX hlx (Catalog #AAA201769) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HLX1 antibody - middle region reacts with Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HLX1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the HLX hlx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGPYAVLTKD TMPQTYKRKR SWSRAVFSNL QRKGLEKRFE IQKYVTKPDR. It is sometimes possible for the material contained within the vial of "HLX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.