Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281082_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of HT-29 cells using 1ug HNMT antibody. Western blot was performed from the immunoprecipitate using HNMT antibody at a dilition of 1:1000.)

Rabbit anti-Human, Mouse HNMT Polyclonal Antibody | anti-HNMT antibody

HNMT Polyclonal Antibody

Gene Names
HNMT; HMT; MRT51; HNMT-S1; HNMT-S2
Reactivity
Human, Mouse
Applications
Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
HNMT, Antibody; HNMT Polyclonal Antibody; HMT; HNMT-S1; HNMT-S2; MRT51; anti-HNMT antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAP
Sequence Length
51
Applicable Applications for anti-HNMT antibody
IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human HNMT
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Positive Samples
HT-29, HepG2, HeLa, Mouse liver, Mouse kidney, Mouse brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 200ug extracts of HT-29 cells using 1ug HNMT antibody. Western blot was performed from the immunoprecipitate using HNMT antibody at a dilition of 1:1000.)

product-image-AAA281082_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 200ug extracts of HT-29 cells using 1ug HNMT antibody. Western blot was performed from the immunoprecipitate using HNMT antibody at a dilition of 1:1000.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded mouse heart using HNMT antibody at dilution of 1:100 (40x lens).)

product-image-AAA281082_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse heart using HNMT antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using HNMT antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA281082_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using HNMT antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-HNMT antibody
In mammals, histamine is metabolized by two major pathways: N(tau)-methylation via histamine N-methyltransferase and oxidative deamination via diamine oxidase. This gene encodes the first enzyme which is found in the cytosol and uses S-adenosyl-L-methionine as the methyl donor. In the mammalian brain, the neurotransmitter activity of histamine is controlled by N(tau)-methylation as diamine oxidase is not found in the central nervous system. A common genetic polymorphism affects the activity levels of this gene product in red blood cells. Multiple alternatively spliced transcript variants that encode different proteins have been found for this gene.
Product Categories/Family for anti-HNMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 6kDa; 14kDa; 33kDa
Observed: 27kDa
NCBI Official Full Name
histamine N-methyltransferase isoform 2
NCBI Official Synonym Full Names
histamine N-methyltransferase
NCBI Official Symbol
HNMT
NCBI Official Synonym Symbols
HMT; MRT51; HNMT-S1; HNMT-S2
NCBI Protein Information
histamine N-methyltransferase
UniProt Protein Name
Histamine N-methyltransferase
UniProt Gene Name
HNMT
UniProt Synonym Gene Names
HMT

Similar Products

Product Notes

The HNMT hnmt (Catalog #AAA281082) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNMT Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HNMT can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HNMT hnmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASSMRSLFS DHGKYVESFR RFLNHSTEHQ CMQEFMDKKL PGIIGRIGDT KSEIKILSIG GGAGEIDLQI LSKVQAQYPG VCINNEVVEP SAEQIAKYKE LVAKTSNLEN VKFAWHKETS SEYQSRMLEK KELQKWDFIH MIQMLYYVKD IPATLKFFHS LLGTNAKMLI IVVSGSSGWD KLWKKYGSRF PQDDLCQYIT SDDLTQMLDN LGLKYECYDL LSTMDISDCF IDGNENGDLL WDFLTETCNF NATAP. It is sometimes possible for the material contained within the vial of "HNMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.