Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198711_WB10.jpg WB (Western Blot) (WB Suggested Anti-HNRPDL Antibody Titration: 1.0ug/mlPositive Control: Daudi cell lysateHNRNPDL is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)

Rabbit HNRNPDL Polyclonal Antibody | anti-HNRNPDL antibody

HNRNPDL Antibody - middle region

Gene Names
HNRNPDL; HNRNP; JKTBP; HNRPDL; JKTBP2; LGMD1G; LGMDD3; laAUF1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
HNRNPDL, Antibody; HNRNPDL Antibody - middle region; anti-HNRNPDL antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL
Sequence Length
363
Applicable Applications for anti-HNRNPDL antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HNRPDL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HNRPDL Antibody Titration: 1.0ug/mlPositive Control: Daudi cell lysateHNRNPDL is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)

product-image-AAA198711_WB10.jpg WB (Western Blot) (WB Suggested Anti-HNRPDL Antibody Titration: 1.0ug/mlPositive Control: Daudi cell lysateHNRNPDL is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells)

IHC (Immunohistochemisry)

(Rabbit Anti-HNRPDL AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198711_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-HNRPDL AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohiostchemistry)

(Rabbit Anti-HNRPDL AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198711_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-HNRPDL AntibodyParaffin Embedded Tissue: Human HeartCellular Data: Myocardial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-HNRNPDL AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198711_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-HNRNPDL AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-HNRNPDL antibody
This is a rabbit polyclonal antibody against HNRPDL. It was validated on Western Blot and immunohistochemistry

Target Description: This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two RRM domains that bind to RNAs. Three alternatively spliced transcript variants have been described for this gene. One of the variants is probably not translated because the transcript is a candidate for nonsense-mediated mRNA decay. The protein isoforms encoded by this gene are similar to its family member HNRPD.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
Heterogeneous nuclear ribonucleoprotein D
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein D like
NCBI Official Symbol
HNRNPDL
NCBI Official Synonym Symbols
HNRNP; JKTBP; HNRPDL; JKTBP2; LGMD1G; LGMDD3; laAUF1
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein D-like
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein D-like
UniProt Gene Name
HNRNPDL
UniProt Synonym Gene Names
HNRPDL; JKTBP; hnRNP D-like; hnRNP DL

Similar Products

Product Notes

The HNRNPDL hnrnpdl (Catalog #AAA198711) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRNPDL Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HNRNPDL can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HNRNPDL hnrnpdl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TMEDMNEYSN IEEFAEGSKI NASKNQQDDG KMFIGGLSWD TSKKDLTEYL. It is sometimes possible for the material contained within the vial of "HNRNPDL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.