Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282317_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using HNRNPR antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit anti-Human HNRNPR Polyclonal Antibody | anti-HNRNPR antibody

HNRNPR Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
GCN1L1; GCN1; GCN1L; PRIC295
Reactivity
Human
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
HNRNPR, Antibody; HNRNPR Rabbit pAb; HNRNPR; HNRPR; hnRNP-R; heterogeneous nuclear ribonucleoprotein R; anti-HNRNPR antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LSAVLQQCLLADVSGIDWMVRHGRSLALSVAVNVAPGRLCAGRYSSDVQEMILSSATADRIPIAVSGVRGMGFLMRHHIETGGGQLPAKLSSLFVKCLQNPSSDIRLVAEKMIWWANKDPLPPLDPQAIKPILKALLDNTKDKNTVVRAYSDQAIVNLLKMRQGEEVFQSLSKILDVASLEVLNEVNRRSLKKLASQADSTEQVDDTILT
Applicable Applications for anti-HNRNPR antibody
IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human HNRNPR (NP_005817.1).
Cellular Location
Cytoplasm, Nucleus, nucleoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using HNRNPR antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282317_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using HNRNPR antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse liver using HNRNPR antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282317_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse liver using HNRNPR antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human esophagus using HNRNPR antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282317_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human esophagus using HNRNPR antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat heart using HNRNPR antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282317_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat heart using HNRNPR antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using HNRNPR antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

product-image-AAA282317_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using HNRNPR antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Related Product Information for anti-HNRNPR antibody
This gene encodes an RNA-binding protein that is a member of the spliceosome C complex, which functions in pre-mRNA processing and transport. The encoded protein also promotes transcription at the c-fos gene. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes 4, 11, and 10.
Product Categories/Family for anti-HNRNPR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
292,758 Da
NCBI Official Full Name
translational activator GCN1
NCBI Official Synonym Full Names
GCN1 general control of amino-acid synthesis 1-like 1 (yeast)
NCBI Official Symbol
GCN1L1
NCBI Official Synonym Symbols
GCN1; GCN1L; PRIC295
NCBI Protein Information
translational activator GCN1; hsGCN1; GCN1-like protein 1; GCN1 (general control of amino-acid synthesis 1, yeast)-like 1; peroxisome proliferator activated receptor interacting complex protein
UniProt Protein Name
Translational activator GCN1
UniProt Gene Name
GCN1L1
UniProt Synonym Gene Names
KIAA0219; HsGCN1
UniProt Entry Name
GCN1L_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HNRNPR gcn1l1 (Catalog #AAA282317) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRNPR Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HNRNPR can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the HNRNPR gcn1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LSAVLQQCLL ADVSGIDWMV RHGRSLALSV AVNVAPGRLC AGRYSSDVQE MILSSATADR IPIAVSGVRG MGFLMRHHIE TGGGQLPAKL SSLFVKCLQN PSSDIRLVAE KMIWWANKDP LPPLDPQAIK PILKALLDNT KDKNTVVRAY SDQAIVNLLK MRQGEEVFQS LSKILDVASL EVLNEVNRRS LKKLASQADS TEQVDDTILT. It is sometimes possible for the material contained within the vial of "HNRNPR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.