Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Rabbit HNRPA3 Polyclonal Antibody | anti-HNRNPA3 antibody

HNRPA3 antibody - N-terminal region

Gene Names
HNRNPA3; FBRNP; HNRPA3; D10S102; 2610510D13Rik
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
HNRPA3, Antibody; HNRPA3 antibody - N-terminal region; anti-HNRNPA3 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
Sequence Length
378
Applicable Applications for anti-HNRNPA3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HNRPA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HNRPA3 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateHNRNPA3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(WB Suggested Anti-HNRPA3 antibody Titration: 1 ug/mLSample Type: Human Daudi)

WB (Western Blot)

(WB Suggested Anti-HNRPA3 antibody Titration: 1 ug/mLSample Type: Human 721_B)

WB (Western Blot)

(Host: RabbitTarget Name: HNRPA3Sample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 0.625ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

WB (Western Blot)

(Host: RabbitTarget Name: HNRPA3Sample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-HNRPA3 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-HNRPA3 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocytesAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Related Product Information for anti-HNRNPA3 antibody
This is a rabbit polyclonal antibody against HNRPA3. It was validated on Western Blot and immunohistochemistry

Target Description: HNRPA3 plays a role in cytoplasmic trafficking of RNA. It binds to the cis-acting response element(A2RE) and may be involved in pre-mRNA splicing
Product Categories/Family for anti-HNRNPA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A3 isoform a
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A3
NCBI Official Symbol
HNRNPA3
NCBI Official Synonym Symbols
FBRNP; HNRPA3; D10S102; 2610510D13Rik
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A3
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A3
UniProt Gene Name
HNRNPA3
UniProt Synonym Gene Names
HNRPA3; hnRNP A3
UniProt Entry Name
ROA3_HUMAN

Similar Products

Product Notes

The HNRNPA3 hnrnpa3 (Catalog #AAA23489) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRPA3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HNRPA3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the HNRNPA3 hnrnpa3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEVKPPPGRP QPDSGRRRRR RGEEGHDPKE PEQLRKLFIG GLSFETTDDS. It is sometimes possible for the material contained within the vial of "HNRPA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.