Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA18726_SDS_PAGE.jpg SDS-PAGE

Transcription factor PU.1 Recombinant Protein | SPI1 recombinant protein

Recombinant Human Transcription factor PU.1

Gene Names
SPI1; OF; PU.1; SFPI1; SPI-1; SPI-A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transcription factor PU.1; N/A; Recombinant Human Transcription factor PU.1; 31 kDa-transforming protein; SPI1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-270aa; Full Length Protein
Sequence
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA18726_SDS_PAGE.jpg SDS-PAGE
Related Product Information for SPI1 recombinant protein
Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing.
Product Categories/Family for SPI1 recombinant protein
References
The human homologue of the putative proto-oncogene Spi-1 characterization and expression in tumors.Ray D., Culine S., Tavitian A., Moreau-Gachelin F.Oncogene 5:663-668(1990) ErratumRay D., Culine S., Tavitian A., Moreau-Gachelin F.Oncogene 5:1611-1612(1990) Full-length cDNA libraries and normalization.Li W.B., Gruber C., Jessee J., Polayes D. Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006) SPI-B activates transcription via a unique proline, serine, and threonine domain and exhibits DNA binding affinity differences from PU.1.Rao S., Matsumura A., Yoon J., Simon M.C.J. Biol. Chem. 274:11115-11124(1999) Functional and physical interactions between AML1 proteins and an ETS protein, MEF implications for the pathogenesis of t(8;21) -positive leukemias.Mao S., Frank R.C., Zhang J., Miyazaki Y., Nimer S.D.Mol. Cell. Biol. 19:3635-3644(1999) The transcriptional repressor GFI-1 antagonizes PU.1 activity through protein-protein interaction.Dahl R., Iyer S.R., Owens K.S., Cuylear D.D., Simon M.C.J. Biol. Chem. 282:6473-6483(2007) BCL6 positively regulates AID and germinal center gene expression via repression of miR-155.Basso K., Schneider C., Shen Q., Holmes A.B., Setty M., Leslie C., Dalla-Favera R.J. Exp. Med. 209:2455-2465(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35.1 kDa
NCBI Official Full Name
transcription factor PU.1 isoform 1
NCBI Official Synonym Full Names
Spi-1 proto-oncogene
NCBI Official Symbol
SPI1
NCBI Official Synonym Symbols
OF; PU.1; SFPI1; SPI-1; SPI-A
NCBI Protein Information
transcription factor PU.1
UniProt Protein Name
Transcription factor PU.1
UniProt Gene Name
SPI1
UniProt Entry Name
SPI1_HUMAN

Similar Products

Product Notes

The SPI1 spi1 (Catalog #AAA18726) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-270aa; Full Length Protein. The amino acid sequence is listed below: MLQACKMEGF PLVPPPSEDL VPYDTDLYQR QTHEYYPYLS SDGESHSDHY WDFHPHHVHS EFESFAENNF TELQSVQPPQ LQQLYRHMEL EQMHVLDTPM VPPHPSLGHQ VSYLPRMCLQ YPSLSPAQPS SDEEEGERQS PPLEVSDGEA DGLEPGPGLL PGETGSKKKI RLYQFLLDLL RSGDMKDSIW WVDKDKGTFQ FSSKHKEALA HRWGIQKGNR KKMTYQKMAR ALRNYGKTGE VKKVKKKLTY QFSGEVLGRG GLAERRHPPH . It is sometimes possible for the material contained within the vial of "Transcription factor PU.1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.