Transcription factor PU.1 Recombinant Protein | SPI1 recombinant protein

Recombinant Human Transcription factor PU.1

Cat. Num. AAA18726

• Gene Names: SPI1; OF; PU.1; SFPI1; SPI-1; SPI-A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transcription factor PU.1; Recombinant Human Transcription factor PU.1; 31 kDa-transforming protein; SPI1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-270aa; Full Length Protein
• Sequence: MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for SPI1 recombinant protein

Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing.

Product Categories/Family for SPI1 recombinant protein

Transcription

References

The human homologue of the putative proto-oncogene Spi-1 characterization and expression in tumors.Ray D., Culine S., Tavitian A., Moreau-Gachelin F.Oncogene 5:663-668(1990) ErratumRay D., Culine S., Tavitian A., Moreau-Gachelin F.Oncogene 5:1611-1612(1990) Full-length cDNA libraries and normalization.Li W.B., Gruber C., Jessee J., Polayes D. Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006) SPI-B activates transcription via a unique proline, serine, and threonine domain and exhibits DNA binding affinity differences from PU.1.Rao S., Matsumura A., Yoon J., Simon M.C.J. Biol. Chem. 274:11115-11124(1999) Functional and physical interactions between AML1 proteins and an ETS protein, MEF implications for the pathogenesis of t(8;21) -positive leukemias.Mao S., Frank R.C., Zhang J., Miyazaki Y., Nimer S.D.Mol. Cell. Biol. 19:3635-3644(1999) The transcriptional repressor GFI-1 antagonizes PU.1 activity through protein-protein interaction.Dahl R., Iyer S.R., Owens K.S., Cuylear D.D., Simon M.C.J. Biol. Chem. 282:6473-6483(2007) BCL6 positively regulates AID and germinal center gene expression via repression of miR-155.Basso K., Schneider C., Shen Q., Holmes A.B., Setty M., Leslie C., Dalla-Favera R.J. Exp. Med. 209:2455-2465(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

NCBI and Uniprot Product Information

• NCBI GI #: 124028521
• NCBI GeneID: 6688
• NCBI Accession #: NP_001074016.1
• NCBI GenBank Nucleotide #: NM_001080547.1
• UniProt Accession #: P17947
• Molecular Weight: 35.1 kDa
• NCBI Official Full Name: transcription factor PU.1 isoform 1
• NCBI Official Synonym Full Names: Spi-1 proto-oncogene
• NCBI Official Symbol: SPI1
• NCBI Official Synonym Symbols: OF; PU.1; SFPI1; SPI-1; SPI-A
• NCBI Protein Information: transcription factor PU.1
• UniProt Protein Name: Transcription factor PU.1
• UniProt Gene Name: SPI1
• UniProt Entry Name: SPI1_HUMAN