Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198466_WB13.jpg WB (Western Blot) (WB Suggested Anti-HOXC10 Antibody Titration: 0.0625ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)

Rabbit HOXC10 Polyclonal Antibody | anti-HOXC10 antibody

HOXC10 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HOXC10; HOX3I
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HOXC10, Antibody; HOXC10 antibody - N-terminal region; anti-HOXC10 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLA
Sequence Length
342
Applicable Applications for anti-HOXC10 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 86%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HOXC10 Antibody Titration: 0.0625ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)

product-image-AAA198466_WB13.jpg WB (Western Blot) (WB Suggested Anti-HOXC10 Antibody Titration: 0.0625ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)

IHC (Immunohistochemistry)

(Human Lung)

product-image-AAA198466_IHC15.jpg IHC (Immunohistochemistry) (Human Lung)
Related Product Information for anti-HOXC10 antibody
This is a rabbit polyclonal antibody against HOXC10. It was validated on Western Blot and immunohistochemistry

Target Description: HOXC10 belongs to the homeobox family. The homeobox family is a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The protein level is controlled during cell differentiation and proliferation, which may indicate this protein has a role in origin activation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
homeobox protein Hox-C10
NCBI Official Synonym Full Names
homeobox C10
NCBI Official Symbol
HOXC10
NCBI Official Synonym Symbols
HOX3I
NCBI Protein Information
homeobox protein Hox-C10
UniProt Protein Name
Homeobox protein Hox-C10
UniProt Gene Name
HOXC10
UniProt Synonym Gene Names
HOX3I
UniProt Entry Name
HXC10_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HOXC10 hoxc10 (Catalog #AAA198466) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXC10 antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HOXC10 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HOXC10 hoxc10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTCPRNVTPN SYAEPLAAPG GGERYSRSAG MYMQSGSDFN CGVMRGCGLA. It is sometimes possible for the material contained within the vial of "HOXC10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.