Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198504_WB10.jpg WB (Western Blot) (WB Suggested Anti-HOXC8 Antibody Titration: 1 ug/mlPositive Control: Fetal Muscle cell lysate)

Rabbit HOXC8 Polyclonal Antibody | anti-HOXC8 antibody

HOXC8 antibody - N-terminal region

Gene Names
HOXC8; HOX3; HOX3A
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HOXC8, Antibody; HOXC8 antibody - N-terminal region; anti-HOXC8 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SHALVYGPGGSAPGFQHASHHVQDFFHHGTSGISNSGYQQNPCSLSCHGD
Sequence Length
242
Applicable Applications for anti-HOXC8 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HOXC8 Antibody Titration: 1 ug/mlPositive Control: Fetal Muscle cell lysate)

product-image-AAA198504_WB10.jpg WB (Western Blot) (WB Suggested Anti-HOXC8 Antibody Titration: 1 ug/mlPositive Control: Fetal Muscle cell lysate)

IHC (Immunohistochemisry)

(Rabbit Anti-HOXC8 AntibodyParaffin Embedded Tissue: Human ColonAntibody Concentration: 5 ug/ml)

product-image-AAA198504_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-HOXC8 AntibodyParaffin Embedded Tissue: Human ColonAntibody Concentration: 5 ug/ml)

IHC (Immunohiostchemistry)

(Sample Type: Human small intestineAnti-HOXC8 antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA198504_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type: Human small intestineAnti-HOXC8 antibody IHC staining of human small intestine. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

IHC (Immunohistochemistry)

(Sample Type: Human ColonAnti-HOXC8 antibody IHC staining of human colon. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

product-image-AAA198504_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human ColonAnti-HOXC8 antibody IHC staining of human colon. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)
Related Product Information for anti-HOXC8 antibody
This is a rabbit polyclonal antibody against HOXC8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. The product of this gene may play a role in the regulation of cartilage differentiation. It could also be involved in chondrodysplasias or other cartilage disorders. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-935 BC053898.1 1-935 936-1866 BC053898.1 937-1867 1867-2290 BU618342.1 3-426 c

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
homeobox protein Hox-C8
NCBI Official Synonym Full Names
homeobox C8
NCBI Official Symbol
HOXC8
NCBI Official Synonym Symbols
HOX3; HOX3A
NCBI Protein Information
homeobox protein Hox-C8
UniProt Protein Name
Homeobox protein Hox-C8
UniProt Gene Name
HOXC8
UniProt Synonym Gene Names
HOX3A
UniProt Entry Name
HXC8_HUMAN

Similar Products

Product Notes

The HOXC8 hoxc8 (Catalog #AAA198504) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HOXC8 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HOXC8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HOXC8 hoxc8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SHALVYGPGG SAPGFQHASH HVQDFFHHGT SGISNSGYQQ NPCSLSCHGD. It is sometimes possible for the material contained within the vial of "HOXC8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.