Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282357_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded mouse kidney using HP1BP3 antibody (AAA282357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

Rabbit HP1BP3 Polyclonal Antibody | anti-HP1BP3 antibody

HP1BP3 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
HP1BP3; HP1-BP74; RP5-930J4.3
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
HP1BP3, Antibody; HP1BP3 Rabbit pAb; HP1BP74; HP1-BP74; anti-HP1BP3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
MATDTSQGELVHPKALPLIVGAQLIHADKLGEKVEDSTMPIRRTVNSTRETPPKSKLAEGEEEKPEPDISSEESVSTVEEQENETPPATSSEAEQPKGEPENEEKEENKSSEETKKDEKDQSKEKEKKVKKTIPSWATLSASQLARAQKQTPMASSPRPK
Applicable Applications for anti-HP1BP3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Positive Samples
LO2
Cellular Location
Chromosome, Nucleus
Research Area
Epigenetics Nuclear Signaling
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human HP1BP3 (NP_057371.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded mouse kidney using HP1BP3 antibody (AAA282357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282357_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded mouse kidney using HP1BP3 antibody (AAA282357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded human tonsil using HP1BP3 antibody (AAA282357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282357_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded human tonsil using HP1BP3 antibody (AAA282357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded rat testis using HP1BP3 antibody (AAA282357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282357_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded rat testis using HP1BP3 antibody (AAA282357) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of LO2 cells, using HP1BP3 antibody (AAA282357) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.)

product-image-AAA282357_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of LO2 cells, using HP1BP3 antibody (AAA282357) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.)
Related Product Information for anti-HP1BP3 antibody
Enables DNA binding activity and nucleosome binding activity. Involved in several processes, including cellular response to hypoxia; heterochromatin organization; and regulation of nucleus size. Located in chromosome and nuclear speck.
Product Categories/Family for anti-HP1BP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
61,207 Da
NCBI Official Full Name
HP1BP3 protein
NCBI Official Synonym Full Names
heterochromatin protein 1, binding protein 3
NCBI Official Symbol
HP1BP3
NCBI Official Synonym Symbols
HP1-BP74; RP5-930J4.3
NCBI Protein Information
heterochromatin protein 1-binding protein 3; HP1-BP74
UniProt Protein Name
Heterochromatin protein 1-binding protein 3
UniProt Gene Name
HP1BP3
UniProt Entry Name
HP1B3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HP1BP3 hp1bp3 (Catalog #AAA282357) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HP1BP3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HP1BP3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HP1BP3 hp1bp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATDTSQGEL VHPKALPLIV GAQLIHADKL GEKVEDSTMP IRRTVNSTRE TPPKSKLAEG EEEKPEPDIS SEESVSTVEE QENETPPATS SEAEQPKGEP ENEEKEENKS SEETKKDEKD QSKEKEKKVK KTIPSWATLS ASQLARAQKQ TPMASSPRPK. It is sometimes possible for the material contained within the vial of "HP1BP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.