Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197486_WB13.jpg WB (Western Blot) (WB Suggested Anti-HR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit HR Polyclonal Antibody | anti-HR antibody

HR antibody - middle region

Gene Names
HR; AU; MUHH; ALUNC; HYPT4; MUHH1; HSA277165
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HR, Antibody; HR antibody - middle region; anti-HR antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVWAPGDAGQQKESTQKTPPTPQPSCNGDTHRTKSIKEETPDSAETPAED
Sequence Length
1189
Applicable Applications for anti-HR antibody
WB (Western Blot)
Homology
Cow: 77%; Dog: 85%; Human: 100%; Mouse: 77%; Pig: 85%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA197486_WB13.jpg WB (Western Blot) (WB Suggested Anti-HR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Rabbit Anti-HR antibodyFormalin Fixed Paraffin Embedded Tissue: Human SkinPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA197486_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-HR antibodyFormalin Fixed Paraffin Embedded Tissue: Human SkinPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-HR antibody
This is a rabbit polyclonal antibody against HR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HR is a protein whose function has been linked to hair growth. A similar protein in rat functions as a transcriptional corepressor for thyroid hormone and interacts with histone deacetylases. Mutations in this gene have been documented in cases of autosomal recessive congenital alopecia and atrichia with papular lesions.This gene encodes a protein whose function has been linked to hair growth. A similar protein in rat functions as a transcriptional corepressor for thyroid hormone and interacts with histone deacetylases. Mutations in this gene have been documented in cases of autosomal recessive congenital alopecia and atrichia with papular lesions. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
127kDa
NCBI Official Full Name
lysine-specific demethylase hairless isoform a
NCBI Official Synonym Full Names
HR lysine demethylase and nuclear receptor corepressor
NCBI Official Symbol
HR
NCBI Official Synonym Symbols
AU; MUHH; ALUNC; HYPT4; MUHH1; HSA277165
NCBI Protein Information
lysine-specific demethylase hairless
UniProt Protein Name
Protein hairless
UniProt Gene Name
HR
UniProt Entry Name
HAIR_HUMAN

Similar Products

Product Notes

The HR hr (Catalog #AAA197486) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HR antibody - middle region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HR hr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVWAPGDAGQ QKESTQKTPP TPQPSCNGDT HRTKSIKEET PDSAETPAED. It is sometimes possible for the material contained within the vial of "HR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.