Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46463_IHC10.jpg IHC (Immunohistochemistry) (Anti- HSD11B2 antibody, IHC(P)IHC(P): Human Placenta Tissue)

HSD11B2 Polyclonal Antibody | anti-HSD11B2 antibody

Anti-HSD11B2 Antibody

Average rating 0.0
No ratings yet
Gene Names
HSD11B2; AME; AME1; HSD2; HSD11K; SDR9C3
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
HSD11B2, Antibody; Anti-HSD11B2 Antibody; Corticosteroid 11-beta-dehydrogenase isozyme 2; 11 beta HSD2; 11 beta hydroxysteroid dehydrogenase type 2; 11 DH2; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-DH2; AME; AME1; Corticosteroid 11 beta dehydrogenase isozyme 2; DHI2_HUMAN; HSD11B2; HSD11K; HSD2; Hydroxysteroid 11 beta dehydrogenase 2; Hydroxysteroid 11 beta dehydrogenase isoenzyme 2; NAD dependent 11 beta hydroxysteroid dehydrogenase; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; SDR9C3; Short chain dehydrogenase/reductase family 9C, member 3; hydroxysteroid (11-beta) dehydrogenase 2; anti-HSD11B2 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
405
Applicable Applications for anti-HSD11B2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HSD11B2 (277-309aa EKRKQLLLANLPQELLQAYGKDYIEHLHGQFLH), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- HSD11B2 antibody, IHC(P)IHC(P): Human Placenta Tissue)

product-image-AAA46463_IHC10.jpg IHC (Immunohistochemistry) (Anti- HSD11B2 antibody, IHC(P)IHC(P): Human Placenta Tissue)

IHC (Immunohistochemisry)

(Anti- HSD11B2 antibody, IHC(P)IHC(P): Rat Pancreas Tissue)

product-image-AAA46463_IHC11.jpg IHC (Immunohistochemisry) (Anti- HSD11B2 antibody, IHC(P)IHC(P): Rat Pancreas Tissue)

IHC (Immunohiostchemistry)

(Anti- HSD11B2 antibody, IHC(P)IHC(P): Mouse Pancreas Tissue)

product-image-AAA46463_IHC13.jpg IHC (Immunohiostchemistry) (Anti- HSD11B2 antibody, IHC(P)IHC(P): Mouse Pancreas Tissue)

WB (Western Blot)

(Anti- HSD11B2 antibody, Western blotting)

product-image-AAA46463_WB15.jpg WB (Western Blot) (Anti- HSD11B2 antibody, Western blotting)
Related Product Information for anti-HSD11B2 antibody
Description: Rabbit IgG polyclonal antibody for Corticosteroid 11-beta-dehydrogenase isozyme 2(HSD11B2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Corticosteroid 11-beta-dehydrogenase isozyme 2, also known as 11-beta-hydroxysteroid dehydrogenase 2, is an enzyme that in humans is encoded by the HSD11B2 gene. There are at least two isozymes of the corticosteroid 11-beta-dehydrogenase, a microsomal enzyme complex responsible for the interconversion of cortisol and cortisone. The type I isozyme has both 11-beta-dehydrogenase (cortisol to cortisone) and 11-oxoreductase (cortisone to cortisol) activities. The type II isozyme, encoded by this gene, has only 11-beta-dehydrogenase activity. In aldosterone-selective epithelial tissues such as the kidney, the type II isozyme catalyzes the glucocorticoid cortisol to the inactive metabolite cortisone, thus preventing illicit activation of the mineralocorticoid receptor. In tissues that do not express the mineralocorticoid receptor, such as the placenta and testis, it protects cells from the growth-inhibiting and/or pro-apoptotic effects of cortisol, particularly during embryonic development. Mutations in this gene cause the syndrome of apparent mineralocorticoid excess and hypertension.
References
1. Albiston AL, Obeyesekere VR, Smith RE, Krozowski ZS (November 1994). "Cloning and tissue distribution of the human 11 beta-hydroxysteroid dehydrogenase type 2 enzyme". Mol. Cell. Endocrinol. 105 (2): R11-7. 2. Brown RW, Chapman KE, Kotelevtsev Y, Yau JL, Lindsay RS, Brett L, Leckie C, Murad P, Lyons V, Mullins JJ, Edwards CR, Seckl JR (February 1996). "Cloning and production of antisera to human placental 11 beta-hydroxysteroid dehydrogenase type 2". Biochem. J. 313 (Pt 3) (Pt 3): 1007-17.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44,127 Da
NCBI Official Full Name
corticosteroid 11-beta-dehydrogenase isozyme 2
NCBI Official Synonym Full Names
hydroxysteroid (11-beta) dehydrogenase 2
NCBI Official Symbol
HSD11B2
NCBI Official Synonym Symbols
AME; AME1; HSD2; HSD11K; SDR9C3
NCBI Protein Information
corticosteroid 11-beta-dehydrogenase isozyme 2
UniProt Protein Name
Corticosteroid 11-beta-dehydrogenase isozyme 2
UniProt Gene Name
HSD11B2
UniProt Synonym Gene Names
; 11-DH2; 11-beta-HSD2; 11-HSD type II; 11-beta-HSD type II; 11-beta-HSD
UniProt Entry Name
DHI2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HSD11B2 hsd11b2 (Catalog #AAA46463) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-HSD11B2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSD11B2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HSD11B2 hsd11b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSD11B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.