Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199404_WB11.jpg WB (Western Blot) (WB Suggested Anti-HSD3B2 AntibodyTitration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Rabbit HSD3B2 Polyclonal Antibody | anti-HSD3B2 antibody

HSD3B2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HSD3B2; HSDB; HSD3B; SDR11E2
Reactivity
Tested: Human, Monkey
Predicted: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Sheep, Monkey
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HSD3B2, Antibody; HSD3B2 antibody - N-terminal region; anti-HSD3B2 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human, Monkey
Predicted: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Sheep, Monkey
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
Sequence Length
372
Applicable Applications for anti-HSD3B2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Predicted Homology
Cow: 85%; Dog: 93%; Goat: 85%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Rat: 86%; Sheep: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B2
Protein Size (# AA)
372 amino acids
Protein Interactions
ATP4A
Preparation and Storage
For short term use, store at 2-8°C up to 1 week.
For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HSD3B2 AntibodyTitration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

product-image-AAA199404_WB11.jpg WB (Western Blot) (WB Suggested Anti-HSD3B2 AntibodyTitration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

IHC (Immunohiostchemistry)

(Sample Type: Monkey vaginaPrimary Antibody Dilution: 1:25Secondary Antibody: Anti-rabbit-HRPSecondary Antibody Dilution: 1:1000Color/Signal Descriptions:Brown: HSD3B2 Blue: NucleusGene Name: HSD3B2Submitted by: Jonathan Bertin, Endoceutics Inc.)

product-image-AAA199404_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type: Monkey vaginaPrimary Antibody Dilution: 1:25Secondary Antibody: Anti-rabbit-HRPSecondary Antibody Dilution: 1:1000Color/Signal Descriptions:Brown: HSD3B2 Blue: NucleusGene Name: HSD3B2Submitted by: Jonathan Bertin, Endoceutics Inc.)

IHC (Immunohistochemistry)

(Sample Type: Monkey adrenal glandPrimary Antibody Dilution: 1:25Secondary Antibody: Anti-rabbit-HRPSecondary Antibody Dilution: 1:1000Color/Signal Descriptions:Brown: HSD3B2 Blue: NucleusGene Name: HSD3B2Submitted by: Jonathan Bertin, Endoceutics Inc.)

product-image-AAA199404_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Monkey adrenal glandPrimary Antibody Dilution: 1:25Secondary Antibody: Anti-rabbit-HRPSecondary Antibody Dilution: 1:1000Color/Signal Descriptions:Brown: HSD3B2 Blue: NucleusGene Name: HSD3B2Submitted by: Jonathan Bertin, Endoceutics Inc.)
Related Product Information for anti-HSD3B2 antibody
3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
Product Categories/Family for anti-HSD3B2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
NCBI Official Synonym Full Names
hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2
NCBI Official Symbol
HSD3B2
NCBI Official Synonym Symbols
HSDB; HSD3B; SDR11E2
NCBI Protein Information
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
UniProt Protein Name
3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2
UniProt Gene Name
HSD3B2
UniProt Synonym Gene Names
HSDB3B; 3-beta-HSD II
UniProt Entry Name
3BHS2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HSD3B2 hsd3b2 (Catalog #AAA199404) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSD3B2 antibody - N-terminal region reacts with Tested: Human, Monkey Predicted: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Sheep, Monkey and may cross-react with other species as described in the data sheet. AAA Biotech's HSD3B2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HSD3B2 hsd3b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GWSCLVTGAG GLLGQRIVRL LVEEKELKEI RALDKAFRPE LREEFSKLQN. It is sometimes possible for the material contained within the vial of "HSD3B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.