Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46464_IHC10.jpg IHC (Immunohistochemistry) (Anti- Hsp90 alpha Picoband antibody, AAA46464, IHC(P)IHC(P): Human Testis Tissue)

Hsp90 alpha Polyclonal Antibody | anti-Hsp90 alpha antibody

Anti-Hsp90 alpha Antibody

Gene Names
HSP90AA1; EL52; HSPN; LAP2; HSP86; HSPC1; HSPCA; Hsp89; Hsp90; LAP-2; HSP89A; HSP90A; HSP90N; HSPCAL1; HSPCAL4; HEL-S-65p
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Hsp90 alpha, Antibody; Anti-Hsp90 alpha Antibody; Heat shock protein HSP 90-alpha; EL52; epididymis luminal secretory protein 52; Heat shock 86 kDa; heat shock 90kD protein 1, alpha; Heat shock 90kD protein 1, alpha like 4; heat shock 90kD protein, alpha-like 4; Heat shock 90kDa protein 1 alpha; Heat shock protein 90kDa alpha (cytosolic) class A member 1; heat shock protein 90kDa alpha (cytosolic), class A member 2; HS90A_HUMAN; HSP 86; HSP86; Hsp89; HSP89A; Hsp90; HSP90A; HSP90AA1; HSP90ALPHA; HSP90N; HSPC1; HSPCA; HSPCAL1; HSPCAL3; HSPCAL4; HSPN; LAP 2; LAP2; lipopolysaccharide-associated protein 2; LPS-associated protein 2; Renal carcinoma antigen NY REN 38; Renal carcinoma antigen NY-REN-38; heat shock protein 90kDa alpha (cytosolic), class A member 1; anti-Hsp90 alpha antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
854
Applicable Applications for anti-Hsp90 alpha antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN Q), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Hsp90 alpha Picoband antibody, AAA46464, IHC(P)IHC(P): Human Testis Tissue)

product-image-AAA46464_IHC10.jpg IHC (Immunohistochemistry) (Anti- Hsp90 alpha Picoband antibody, AAA46464, IHC(P)IHC(P): Human Testis Tissue)

IHC (Immunohistochemisry)

(Anti- Hsp90 alpha Picoband antibody, AAA46464, IHC(P)IHC(P): Rat Testis Tissue)

product-image-AAA46464_IHC11.jpg IHC (Immunohistochemisry) (Anti- Hsp90 alpha Picoband antibody, AAA46464, IHC(P)IHC(P): Rat Testis Tissue)

IHC (Immunohiostchemistry)

(Anti- Hsp90 alpha Picoband antibody, AAA46464, IHC(P)IHC(P): Mouse Testis Tissue)

product-image-AAA46464_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Hsp90 alpha Picoband antibody, AAA46464, IHC(P)IHC(P): Mouse Testis Tissue)

WB (Western Blot)

(Anti- Hsp90 alpha Picoband antibody, AAA46464, Western blottingAll lanes: Anti Hsp90 alpha (AAA46464) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Cardiac Muscle Tissue Lysate at 50ugLane 3: Rat Liver Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: JURKAT Whole Cell Lysate at 40ugLane 6: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 90KDObserved bind size: 90KD)

product-image-AAA46464_WB15.jpg WB (Western Blot) (Anti- Hsp90 alpha Picoband antibody, AAA46464, Western blottingAll lanes: Anti Hsp90 alpha (AAA46464) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Cardiac Muscle Tissue Lysate at 50ugLane 3: Rat Liver Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: JURKAT Whole Cell Lysate at 40ugLane 6: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 90KDObserved bind size: 90KD)
Related Product Information for anti-Hsp90 alpha antibody
Description: Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-alpha(HSP90AA1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. The gene, HSP90AA1, encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.
References
1. Chen B, Piel WH, Gui L, Bruford E, Monteiro A (Dec 2005). "The HSP90 family of genes in the human genome: insights into their divergence and evolution". Genomics86 (6): 627-37. 2. Hickey E, Brandon SE, Smale G, Lloyd D, Weber LA (Jun 1989). "Sequence and regulation of a gene encoding a human 89-kilodalton heat shock protein". Molecular and Cellular Biology 9 (6): 2615-26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98,161 Da
NCBI Official Full Name
heat shock protein HSP 90-alpha isoform 1
NCBI Official Synonym Full Names
heat shock protein 90kDa alpha family class A member 1
NCBI Official Symbol
HSP90AA1
NCBI Official Synonym Symbols
EL52; HSPN; LAP2; HSP86; HSPC1; HSPCA; Hsp89; Hsp90; LAP-2; HSP89A; HSP90A; HSP90N; HSPCAL1; HSPCAL4; HEL-S-65p
NCBI Protein Information
heat shock protein HSP 90-alpha
UniProt Protein Name
Heat shock protein HSP 90-alpha
UniProt Gene Name
HSP90AA1
UniProt Synonym Gene Names
HSP90A; HSPC1; HSPCA; HSP 86; HSP86; LAP-2; LPS-associated protein 2
UniProt Entry Name
HS90A_HUMAN

Similar Products

Product Notes

The Hsp90 alpha hsp90aa1 (Catalog #AAA46464) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Hsp90 alpha Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hsp90 alpha can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Hsp90 alpha hsp90aa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hsp90 alpha, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.