Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46382_IHC10.jpg IHC (Immunohistochemistry) (Anti- Hsp90 beta Picoband antibody, AAA46382, IHC(P)IHC(P): Human Placenta Tissue)

Hsp90 beta Polyclonal Antibody | anti-HSP90AB1 antibody

Anti-Hsp90 beta Antibody

Average rating 0.0
No ratings yet
Gene Names
HSP90AB1; HSP84; HSPC2; HSPCB; D6S182; HSP90B
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Hsp90 beta, Antibody; Anti-Hsp90 beta Antibody; Heat shock protein HSP 90-beta; 90 kda heat shock protein beta HSP90 beta; D6S182; FLJ26984; Heat shock 84 kDa; Heat shock 90kD protein 1, beta; Heat shock 90kDa protein 1 beta; Heat shock protein 90kDa alpha (cytosolic) class B member 1; Heat shock protein beta; Heat shock protein HSP 90 beta; HS90B_HUMAN; HSP 84; HSP 90; HSP 90 b; HSP 90b; HSP84; HSP90 BETA; hsp90ab1; HSP90B; HSPC2; HSPCB; heat shock protein 90kDa alpha (cytosolic), class B member 1; anti-HSP90AB1 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
724
Applicable Applications for anti-HSP90AB1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Hsp90 beta Picoband antibody, AAA46382, IHC(P)IHC(P): Human Placenta Tissue)

product-image-AAA46382_IHC10.jpg IHC (Immunohistochemistry) (Anti- Hsp90 beta Picoband antibody, AAA46382, IHC(P)IHC(P): Human Placenta Tissue)

IHC (Immunohistochemisry)

(Anti- Hsp90 beta Picoband antibody, AAA46382, IHC(P)IHC(P): Rat Intestine Tissue)

product-image-AAA46382_IHC11.jpg IHC (Immunohistochemisry) (Anti- Hsp90 beta Picoband antibody, AAA46382, IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- Hsp90 beta Picoband antibody, AAA46382, IHC(P)IHC(P): Mouse Testis Tissue)

product-image-AAA46382_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Hsp90 beta Picoband antibody, AAA46382, IHC(P)IHC(P): Mouse Testis Tissue)

WB (Western Blot)

(Anti- Hsp90 beta Picoband antibody, AAA46382, Western blottingAll lanes: Anti Hsp90 beta (AAA46382) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: SW620 Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugPredicted bind size: 90KDObserved bind size: 90KD)

product-image-AAA46382_WB15.jpg WB (Western Blot) (Anti- Hsp90 beta Picoband antibody, AAA46382, Western blottingAll lanes: Anti Hsp90 beta (AAA46382) at 0.5ug/mlLane 1: Rat Testis Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: SW620 Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugPredicted bind size: 90KDObserved bind size: 90KD)
Related Product Information for anti-HSP90AB1 antibody
Description: Rabbit IgG polyclonal antibody for Heat shock protein HSP 90-beta(HSP90AB1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.
References
1. "Entrez Gene: HSP90AB1 Heat shock protein 90kDa alpha (cytosolic), class B member 1". 2. Chen B, Piel WH, Gui L, Bruford E, Monteiro A (Dec 2005). "The HSP90 family of genes in the human genome: insights into their divergence and evolution". Genomics 86 (6): 627-37. 3. Rebbe NF, Hickman WS, Ley TJ, Stafford DW, Hickman S (Sep 1989). "Nucleotide sequence and regulation of a human 90-kDa heat shock protein gene". The Journal of Biological Chemistry 264 (25): 15006-11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83,264 Da
NCBI Official Full Name
heat shock protein HSP 90-beta isoform a
NCBI Official Synonym Full Names
heat shock protein 90kDa alpha family class B member 1
NCBI Official Symbol
HSP90AB1
NCBI Official Synonym Symbols
HSP84; HSPC2; HSPCB; D6S182; HSP90B
NCBI Protein Information
heat shock protein HSP 90-beta
UniProt Protein Name
Heat shock protein HSP 90-beta
UniProt Gene Name
HSP90AB1
UniProt Synonym Gene Names
HSP90B; HSPC2; HSPCB; HSP 90; HSP 84; HSP84
UniProt Entry Name
HS90B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HSP90AB1 hsp90ab1 (Catalog #AAA46382) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Hsp90 beta Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hsp90 beta can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HSP90AB1 hsp90ab1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hsp90 beta, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.