Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201072_WB11.jpg WB (Western Blot) (WB Suggested Anti-Hsp90aa1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Rabbit Hsp90aa1 Polyclonal Antibody | anti-HSP90AA1 antibody

Hsp90aa1 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
Hsp90aa1; hsp4; 86kDa; 89kDa; Hsp89; Hsp90; Hspca; Hsp86-1; AL024080; AL024147
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Hsp90aa1, Antibody; Hsp90aa1 antibody - C-terminal region; anti-HSP90AA1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALL
Sequence Length
733
Applicable Applications for anti-HSP90AA1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Hsp90aa1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

product-image-AAA201072_WB11.jpg WB (Western Blot) (WB Suggested Anti-Hsp90aa1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

WB (Western Blot)

(Host: RatTarget Name: HSP90AA1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

product-image-AAA201072_WB13.jpg WB (Western Blot) (Host: RatTarget Name: HSP90AA1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: HSP90AA1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

product-image-AAA201072_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: HSP90AA1Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-HSP90AA1 antibody
This is a rabbit polyclonal antibody against Hsp90aa1. It was validated on Western Blot

Target Description: Hsp90aa1 is a molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Hsp90aa1 undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Hsp90aa1 interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa
NCBI Official Full Name
heat shock protein HSP 90-alpha
NCBI Official Synonym Full Names
heat shock protein 90, alpha (cytosolic), class A member 1
NCBI Official Symbol
Hsp90aa1
NCBI Official Synonym Symbols
hsp4; 86kDa; 89kDa; Hsp89; Hsp90; Hspca; Hsp86-1; AL024080; AL024147
NCBI Protein Information
heat shock protein HSP 90-alpha
UniProt Protein Name
Heat shock protein HSP 90-alpha
UniProt Gene Name
Hsp90aa1
UniProt Synonym Gene Names
Hsp86; Hsp86-1; Hspca; HSP 86; HSP86; TSTA
UniProt Entry Name
HS90A_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HSP90AA1 hsp90aa1 (Catalog #AAA201072) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hsp90aa1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Hsp90aa1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HSP90AA1 hsp90aa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STMGYMAAKK HLEINPDHSI IETLRQKAEA DKNDKSVKDL VILLYETALL. It is sometimes possible for the material contained within the vial of "Hsp90aa1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.