Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201049_WB10.jpg WB (Western Blot) (WB Suggested Anti-Hspa1a AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

Rabbit Hspa1a Polyclonal Antibody | anti-HSPA1A antibody

Hspa1a antibody - N-terminal region

Gene Names
Hspa1a; Hsp72; hsp68; Hsp70-3; Hsp70.3; hsp70A1
Reactivity
Dog, Goat, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Hspa1a, Antibody; Hspa1a antibody - N-terminal region; anti-HSPA1A antibody
Ordering
Host
Rabbit
Reactivity
Dog, Goat, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KMKEIAEAYLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINE
Sequence Length
641
Applicable Applications for anti-HSPA1A antibody
WB (Western Blot)
Homology
Dog: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Hspa1a AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

product-image-AAA201049_WB10.jpg WB (Western Blot) (WB Suggested Anti-Hspa1a AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)

WB (Western Blot)

(WB Suggested Anti-Hspa1a AntibodyPositive Control: Lane 1: 80ug pig serumPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna)

product-image-AAA201049_WB11.jpg WB (Western Blot) (WB Suggested Anti-Hspa1a AntibodyPositive Control: Lane 1: 80ug pig serumPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna)

WB (Western Blot)

(WB Suggested Anti-Hspa1a AntibodyPositive Control: Lane 1: 80ug pig serumPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna)

product-image-AAA201049_WB13.jpg WB (Western Blot) (WB Suggested Anti-Hspa1a AntibodyPositive Control: Lane 1: 80ug pig serumPrimary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1000Submitted by: Martina Ondrovics, University of Veterinary Medicine Vienna)

WB (Western Blot)

(Lanes:Lane1: 10ug mouse cortex brain lysateLane2: 25ug mouse cortex brain lysateLane3: 40ug mouse cortex brain lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:Hspa1aSubmitted by:Anonymous)

product-image-AAA201049_WB15.jpg WB (Western Blot) (Lanes:Lane1: 10ug mouse cortex brain lysateLane2: 25ug mouse cortex brain lysateLane3: 40ug mouse cortex brain lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:2000Gene Name:Hspa1aSubmitted by:Anonymous)
Related Product Information for anti-HSPA1A antibody
This is a rabbit polyclonal antibody against Hspa1a. It was validated on Western Blot

Target Description: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
heat shock 70 kDa protein 1A
NCBI Official Synonym Full Names
heat shock protein 1A
NCBI Official Symbol
Hspa1a
NCBI Official Synonym Symbols
Hsp72; hsp68; Hsp70-3; Hsp70.3; hsp70A1
NCBI Protein Information
heat shock 70 kDa protein 1A
UniProt Protein Name
Heat shock 70 kDa protein 1A
UniProt Gene Name
Hspa1a
UniProt Synonym Gene Names
Hsp70-3; Hsp70A1; HSP70.3

Similar Products

Product Notes

The HSPA1A hspa1a (Catalog #AAA201049) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hspa1a antibody - N-terminal region reacts with Dog, Goat, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Hspa1a can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HSPA1A hspa1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KMKEIAEAYL GHPVTNAVIT VPAYFNDSQR QATKDAGVIA GLNVLRIINE. It is sometimes possible for the material contained within the vial of "Hspa1a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.