Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201241_WB13.jpg WB (Western Blot) (WB Suggested Anti-HSPA1B AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellHSPA1B is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells)

Rabbit HSPA1B Polyclonal Antibody | anti-HSPA1B antibody

HSPA1B antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
HSPA1B; HSP72; HSPA1; HSX70; HSP70-1; HSP70-2; HSP70.1; HSP70.2; HSP70-1B
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HSPA1B, Antibody; HSPA1B antibody - C-terminal region; anti-HSPA1B antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNA
Sequence Length
641
Applicable Applications for anti-HSPA1B antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Sheep: 100%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-HSPA1B AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellHSPA1B is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells)

product-image-AAA201241_WB13.jpg WB (Western Blot) (WB Suggested Anti-HSPA1B AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellHSPA1B is strongly supported by BioGPS gene expression data to be expressed in Human MDA-MB435 cells)

IHC (Immunohistochemistry)

(Rabbit Anti-HSPA1B antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ProstateObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201241_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-HSPA1B antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult ProstateObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-HSPA1B antibody
This is a rabbit polyclonal antibody against HSPA1B. It was validated on Western Blot

Target Description: This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which encode similar proteins.
Product Categories/Family for anti-HSPA1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
heat shock 70 kDa protein 1B
NCBI Official Synonym Full Names
heat shock protein family A (Hsp70) member 1B
NCBI Official Symbol
HSPA1B
NCBI Official Synonym Symbols
HSP72; HSPA1; HSX70; HSP70-1; HSP70-2; HSP70.1; HSP70.2; HSP70-1B
NCBI Protein Information
heat shock 70 kDa protein 1B
UniProt Protein Name
Heat shock 70 kDa protein 1A/1B
UniProt Gene Name
HSPA1A
UniProt Synonym Gene Names
HSPA1; HSP70-1/HSP70-2
UniProt Entry Name
HSP71_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HSPA1B hspa1a (Catalog #AAA201241) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPA1B antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA1B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the HSPA1B hspa1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DKSTGKANKI TITNDKGRLS KEEIERMVQE AEKYKAEDEV QRERVSAKNA. It is sometimes possible for the material contained within the vial of "HSPA1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.