Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46331_IHC10.jpg IHC (Immunohistochemistry) (Anti- HSPA2 Picoband antibody, AAA46331,IHC(P)IHC(P): Human Lung Cancer Tissue)

HSPA2 Polyclonal Antibody | anti-HSPA2 antibody

Anti-HSPA2 Antibody

Average rating 0.0
No ratings yet
Gene Names
HSPA2; HSP70-2; HSP70-3
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
HSPA2, Antibody; Anti-HSPA2 Antibody; Heat shock-related 70 kDa protein 2; 70kDa; DAQB 147D11.1 001; Hcp70.2; Heat shock 70 kDa protein 2; heat shock 70kDa protein 1A; Heat shock protein 2; heat shock protein 70; Heat shock protein 70.2; Heat shock related 70 kDa protein 2; Heat-shock protein, 70-KD, 2; Heat-shock protein, 70-KD, 3; HSP70 2; HSP70 3; Hsp70-2; HSP70-3; HSP70.2; HSP70A2; HSP72; HSP72_HUMAN; HSPA2; Hspt70; Hst70; MGC58299; MGC7795; MGC93458; OTTHUMP00000180664; Testis-specific heat shock protein-related; XXbac BCX40G17.3 001 antibody; heat shock 70kDa protein 2; anti-HSPA2 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
639
Applicable Applications for anti-HSPA2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- HSPA2 Picoband antibody, AAA46331,IHC(P)IHC(P): Human Lung Cancer Tissue)

product-image-AAA46331_IHC10.jpg IHC (Immunohistochemistry) (Anti- HSPA2 Picoband antibody, AAA46331,IHC(P)IHC(P): Human Lung Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- HSPA2 Picoband antibody, AAA46331,IHC(P)IHC(P): Rat Intestine Tissue)

product-image-AAA46331_IHC11.jpg IHC (Immunohistochemisry) (Anti- HSPA2 Picoband antibody, AAA46331,IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- HSPA2 Picoband antibody, AAA46331,IHC(P)IHC(P): Mouse Intestine Tissue)

product-image-AAA46331_IHC13.jpg IHC (Immunohiostchemistry) (Anti- HSPA2 Picoband antibody, AAA46331,IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- HSPA2 Picoband antibody, AAA46331, Western blottingAll lanes: Anti HSPA2 (AAA46331) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Rat Testis Tissue Lysate at 50ugLane 4: Mouse Liver Tissue Lysate at 50ugLane 5: Mouse Kidney Tissue Lysate at 50ugLane 6: HELA Whole Cell Lysate at 40ugLane 7: MCF-7 Whole Cell Lysate at 40ugLane 8: A375 Whole Cell Lysate at 40ugLane 9: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 70KDObserved bind size: 70KD)

product-image-AAA46331_WB15.jpg WB (Western Blot) (Anti- HSPA2 Picoband antibody, AAA46331, Western blottingAll lanes: Anti HSPA2 (AAA46331) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Thymus Tissue Lysate at 50ugLane 3: Rat Testis Tissue Lysate at 50ugLane 4: Mouse Liver Tissue Lysate at 50ugLane 5: Mouse Kidney Tissue Lysate at 50ugLane 6: HELA Whole Cell Lysate at 40ugLane 7: MCF-7 Whole Cell Lysate at 40ugLane 8: A375 Whole Cell Lysate at 40ugLane 9: NIH3T3 Whole Cell Lysate at 40ugPredicted bind size: 70KDObserved bind size: 70KD)
Related Product Information for anti-HSPA2 antibody
Description: Rabbit IgG polyclonal antibody for Heat shock-related 70 kDa protein 2(HSPA2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: HSPA2 (heat shock 70kDa protein 2) is also known as HEAT-SHOCK PROTEIN, 70-KD, 2, HSP70-2, HEAT-SHOCK PROTEIN, 70-KD, 3 or HSP70-3. Analysis of the sequence indicated that HSPA2 is the human homolog of the murine Hsp70-2 gene, with 91.7% identity in the nucleotide coding sequence and 98.2% in the corresponding amino acid sequence. HSPA2 has less amino acid homology to the other members of the human HSP70 gene family. HSPA2 is constitutively expressed in most tissues, with very high levels in testis and skeletal muscle. The HSPA2 gene is located on chromosome 14q22-q24. Immunohistochemical analysis detected weak expression of HSPA2 in spermatocytes and stronger expression in spermatids and in the tail of mature sperm. HSPA2 may be critical to sperm maturation through its role as a protein chaperone.
References
1. Bonnycastle, L. L. C., Yu, C.-E., Hunt, C. R., Trask, B. J., Clancy, K. P., Weber, J. L., Patterson, D., Schellenberg, G. D. Cloning, sequencing, and mapping of the human chromosome 14 heat shock protein gene (HSPA2). Genomics 23: 85-93, 1994. 2. Dix, D. J., Allen, J. W., Collins, B. W., Mori, C., Nakamura, N., Poorman-Allen, P., Goulding, E. H., Eddy, E. M. Targeted gene disruption of Hsp70-2 results in failed meiosis, germ cell apoptosis, and male infertility. Proc. Nat. Acad. Sci. 93: 3264-3268, 1996. 3. Hunt, C. R., Gasser, D. L., Chaplin, D. D., Pierce, J. C., Kozak, C. A. Chromosomal localization of five murine HSP70 gene family members: Hsp70-1, Hsp70-2, Hsp70-3, Hsc70t and Grp78. Genomics 16: 193-198, 1993.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,021 Da
NCBI Official Full Name
heat shock-related 70 kDa protein 2
NCBI Official Synonym Full Names
heat shock protein family A (Hsp70) member 2
NCBI Official Symbol
HSPA2
NCBI Official Synonym Symbols
HSP70-2; HSP70-3
NCBI Protein Information
heat shock-related 70 kDa protein 2
UniProt Protein Name
Heat shock-related 70 kDa protein 2
UniProt Gene Name
HSPA2
UniProt Synonym Gene Names
Heat shock 70 kDa protein 2
UniProt Entry Name
HSP72_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HSPA2 hspa2 (Catalog #AAA46331) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-HSPA2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HSPA2 hspa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSPA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.