Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201717_WB10.jpg WB (Western Blot) (HTR1A antibody - N-terminal region validated by WB using primary cultured neurons)

Rabbit anti-Human HTR1A Polyclonal Antibody | anti-HTR1A antibody

HTR1A antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
HTR1A; G-21; 5HT1a; PFMCD; 5-HT1A; 5-HT-1A; ADRBRL1; ADRB2RL1
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purified
Synonyms
HTR1A, Antibody; HTR1A antibody - N-terminal region; anti-HTR1A antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
Sequence Length
422
Applicable Applications for anti-HTR1A antibody
IF (Immunofluorescence), WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(HTR1A antibody - N-terminal region validated by WB using primary cultured neurons)

product-image-AAA201717_WB10.jpg WB (Western Blot) (HTR1A antibody - N-terminal region validated by WB using primary cultured neurons)

WB (Western Blot)

(Host: RabbitTarget Name: HTR1ASample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

product-image-AAA201717_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: HTR1ASample Type: JurkatLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1.0ug/mLPeptide Concentration: 1.0ug/mLLysate Quantity: 25ug/laneGel Concentration: 12%)

WB (Western Blot)

(Host: RabbitTarget Name: HTR1ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201717_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: HTR1ASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

IF (Immunofluorescence)

(Primary cultured neurons 5HT1A ReceptorsDilution:Primary: 1:200Secondary: 1:2000)

product-image-AAA201717_IF15.jpg IF (Immunofluorescence) (Primary cultured neurons 5HT1A ReceptorsDilution:Primary: 1:200Secondary: 1:2000)
Related Product Information for anti-HTR1A antibody
This is a rabbit polyclonal antibody against HTR1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibits adenylate cyclase activity.
Product Categories/Family for anti-HTR1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 1A
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 1A
NCBI Official Symbol
HTR1A
NCBI Official Synonym Symbols
G-21; 5HT1a; PFMCD; 5-HT1A; 5-HT-1A; ADRBRL1; ADRB2RL1
NCBI Protein Information
5-hydroxytryptamine receptor 1A
UniProt Protein Name
5-hydroxytryptamine receptor 1A
UniProt Gene Name
HTR1A
UniProt Synonym Gene Names
ADRB2RL1; ADRBRL1; 5-HT-1A; 5-HT1A
UniProt Entry Name
5HT1A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HTR1A htr1a (Catalog #AAA201717) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTR1A antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HTR1A can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the HTR1A htr1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQGNNTTSPP APFETGGNTT GISDVTVSYQ VITSLLLGTL IFCAVLGNAC. It is sometimes possible for the material contained within the vial of "HTR1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.