Rabbit HTR3E Polyclonal Antibody | anti-HTR3E antibody
HTR3E antibody - middle region
Gene Names
HTR3E; 5-HT3E; 5-HT3-E; 5-HT3c1
Reactivity
Dog, Horse, Human, Rabbit
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
HTR3E, Antibody; HTR3E antibody - middle region; anti-HTR3E antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG
Sequence Length
471
Applicable Applications for anti-HTR3E antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Dog: 100%; Horse: 83%; Human: 100%; Rabbit: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HTR3E
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-HTR3E antibody
This is a rabbit polyclonal antibody against HTR3E. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: HTR3E belongs to the ligand-gated ion channel receptor superfamily. HTR3E is a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its full length sequence has not been determined.
Target Description: HTR3E belongs to the ligand-gated ion channel receptor superfamily. HTR3E is a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its full length sequence has not been determined.
Product Categories/Family for anti-HTR3E antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 3E isoform a
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 3E
NCBI Official Symbol
HTR3E
NCBI Official Synonym Symbols
5-HT3E; 5-HT3-E; 5-HT3c1
NCBI Protein Information
5-hydroxytryptamine receptor 3E
UniProt Protein Name
5-hydroxytryptamine receptor 3E
UniProt Gene Name
HTR3E
UniProt Synonym Gene Names
5-HT3-E; 5-HT3E
UniProt Entry Name
5HT3E_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The HTR3E htr3e (Catalog #AAA197992) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTR3E antibody - middle region reacts with Dog, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's HTR3E can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the HTR3E htr3e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RWLHSLLLHC NSPGRCCPTA PQKENKGPGL TPTHLPGVKE PEVSAGQMPG. It is sometimes possible for the material contained within the vial of "HTR3E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
