Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA124671_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of HTRA1 using anti-HTRA1 antibody (AAA124671).HTRA1 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-HTRA1 Antibody (AAA124671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Rabbit HTRA1/Htra Polyclonal Antibody | anti-HTRA1 antibody

Anti-HTRA1/Htra Picoband antibody

Gene Names
HTRA1; L56; HtrA; ARMD7; ORF480; PRSS11; CARASIL; CADASIL2
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Western Blot, Immunohistochemistry
Synonyms
HTRA1/Htra, Antibody; Anti-HTRA1/Htra Picoband antibody; Serine protease HTRA1; High-temperature requirement A serine peptidase 1; L56; Serine protease 11; HTRA1; HTRA; PRSS11; anti-HTRA1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Form/Format
Lyophilized
Sequence Length
480
Applicable Applications for anti-HTRA1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Immunogen
A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD).
Subcellular Localization
Cell membrane.
Tissue Specificity
Widely expressed, with strongest expression in placenta (at protein level). Secreted by synovial fibroblasts. Up- regulated in osteoarthritis and rheumatoid arthritis synovial fluids and cartilage as compared with non-arthritic (at protein level).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of HTRA1 using anti-HTRA1 antibody (AAA124671).HTRA1 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-HTRA1 Antibody (AAA124671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA124671_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of HTRA1 using anti-HTRA1 antibody (AAA124671).HTRA1 was detected in paraffin-embedded section of human rectal cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-HTRA1 Antibody (AAA124671) overnight at 4 degree C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of HTRA1 using anti-HTRA1 antibody (AAA124671).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human MCF-7 whole cell lysates,Lane 2: rat heart tissue lysates,Lane 3: mouse heart tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HTRA1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HTRA1 at approximately 51KD. The expected band size for HTRA1 is at 51KD.)

product-image-AAA124671_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of HTRA1 using anti-HTRA1 antibody (AAA124671).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human MCF-7 whole cell lysates,Lane 2: rat heart tissue lysates,Lane 3: mouse heart tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-HTRA1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for HTRA1 at approximately 51KD. The expected band size for HTRA1 is at 51KD.)
Related Product Information for anti-HTRA1 antibody
Description: Serine protease HTRA1 is an enzyme that in humans is encoded by the HTRA1 gene. This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.
Protein Function: Serine protease with a variety of targets, including extracellular matrix proteins such as fibronectin. HTRA1-generated fibronectin fragments further induce synovial cells to up-regulate MMP1 and MMP3 production. May also degrade proteoglycans, such as aggrecan, decorin and fibromodulin. Through cleavage of proteoglycans, may release soluble FGF-glycosaminoglycan complexes that promote the range and intensity of FGF signals in the extracellular space. Regulates the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. Inhibits signaling mediated by TGF-beta family members. This activity requires the integrity of the catalytic site, although it is unclear whether TGF-beta proteins are themselves degraded. By acting on TGF-beta signaling, may regulate many physiological processes, including retinal angiogenesis and neuronal survival and maturation during development. Intracellularly, degrades TSC2, leading to the activation of TSC2 downstream targets.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,287 Da
NCBI Official Full Name
serine protease HTRA1
NCBI Official Synonym Full Names
HtrA serine peptidase 1
NCBI Official Symbol
HTRA1
NCBI Official Synonym Symbols
L56; HtrA; ARMD7; ORF480; PRSS11; CARASIL; CADASIL2
NCBI Protein Information
serine protease HTRA1
UniProt Protein Name
Serine protease HTRA1
UniProt Gene Name
HTRA1
UniProt Synonym Gene Names
HTRA; PRSS11

Similar Products

Product Notes

The HTRA1 htra1 (Catalog #AAA124671) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-HTRA1/Htra Picoband antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's HTRA1/Htra can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the HTRA1 htra1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HTRA1/Htra, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.