Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200448_WB13.jpg WB (Western Blot) (WB Suggested Anti-IARS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit IARS Polyclonal Antibody | anti-IARS antibody

IARS antibody - middle region

Gene Names
IARS; IRS; ILRS; IARS1; ILERS; GRIDHH; PRO0785
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IARS, Antibody; IARS antibody - middle region; anti-IARS antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD
Sequence Length
1262
Applicable Applications for anti-IARS antibody
WB (Western Blot)
Homology
Cow: 85%; Dog: 85%; Guinea Pig: 93%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IARS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IARS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

product-image-AAA200448_WB13.jpg WB (Western Blot) (WB Suggested Anti-IARS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Rabbit Anti-IARS antibodyFormalin Fixed Paraffin Embedded Tissue: Human ThyroidPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA200448_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-IARS antibodyFormalin Fixed Paraffin Embedded Tissue: Human ThyroidPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-IARS antibody
This is a rabbit polyclonal antibody against IARS. It was validated on Western Blot

Target Description: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs.
Product Categories/Family for anti-IARS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
144kDa
NCBI Official Full Name
isoleucine--tRNA ligase, cytoplasmic
NCBI Official Synonym Full Names
isoleucyl-tRNA synthetase
NCBI Official Symbol
IARS
NCBI Official Synonym Symbols
IRS; ILRS; IARS1; ILERS; GRIDHH; PRO0785
NCBI Protein Information
isoleucine--tRNA ligase, cytoplasmic
UniProt Protein Name
Isoleucine--tRNA ligase, cytoplasmic
UniProt Gene Name
IARS
UniProt Synonym Gene Names
IRS; IleRS

Similar Products

Product Notes

The IARS iars (Catalog #AAA200448) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IARS antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IARS can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IARS iars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YEAAKVFGLR SRKLKLFLNE TQTQEITEDI PVKTLNMKTV YVSVLPTTAD. It is sometimes possible for the material contained within the vial of "IARS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.