Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201791_WB11.jpg WB (Western Blot) (WB Suggested Anti-ID2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

Rabbit ID2 Polyclonal Antibody | anti-ID2 antibody

ID2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ID2; GIG8; ID2A; ID2H; bHLHb26
Reactivity
Cow, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ID2, Antibody; ID2 antibody - middle region; anti-ID2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALC
Sequence Length
134
Applicable Applications for anti-ID2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Human: 100%; Mouse: 100%; Pig: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ID2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ID2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

product-image-AAA201791_WB11.jpg WB (Western Blot) (WB Suggested Anti-ID2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Thymus)

IHC (Immunohiostchemistry)

(Rabbit Anti-ID2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Nucleus in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201791_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-ID2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Nucleus in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Rabbit Anti-ID2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201791_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ID2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ID2 antibody
This is a rabbit polyclonal antibody against ID2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ID2 belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation.The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
DNA-binding protein inhibitor ID-2
NCBI Official Synonym Full Names
inhibitor of DNA binding 2
NCBI Official Symbol
ID2
NCBI Official Synonym Symbols
GIG8; ID2A; ID2H; bHLHb26
NCBI Protein Information
DNA-binding protein inhibitor ID-2
UniProt Protein Name
DNA-binding protein inhibitor ID-2
UniProt Gene Name
ID2
UniProt Synonym Gene Names
BHLHB26; bHLHb26
UniProt Entry Name
ID2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ID2 id2 (Catalog #AAA201791) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ID2 antibody - middle region reacts with Cow, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ID2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ID2 id2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TIVSLHHQRP GQNQASRTPL TTLNTDISIL SLQASEFPSE LMSNDSKALC. It is sometimes possible for the material contained within the vial of "ID2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.