Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23561_WB6.jpg WB (Western Blot) (WB Suggested Anti-IDH1 Antibody Titration: 1 ug/mlPositive Control: Fetal liver cell lysate)

Rabbit IDH1 Polyclonal Antibody | anti-IDH1 antibody

IDH1 antibody - C-terminal region

Gene Names
IDH1; IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
IDH1, Antibody; IDH1 antibody - C-terminal region; anti-IDH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
Sequence Length
414
Applicable Applications for anti-IDH1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human IDH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IDH1 Antibody Titration: 1 ug/mlPositive Control: Fetal liver cell lysate)

product-image-AAA23561_WB6.jpg WB (Western Blot) (WB Suggested Anti-IDH1 Antibody Titration: 1 ug/mlPositive Control: Fetal liver cell lysate)

WB (Western Blot)

(Host: RatTarget Name: IDH1Sample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

product-image-AAA23561_WB5.jpg WB (Western Blot) (Host: RatTarget Name: IDH1Sample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: IDH1Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlIDH1 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA23561_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: IDH1Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlIDH1 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: IDH1Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlIDH1 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA23561_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: IDH1Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlIDH1 is supported by BioGPS gene expression data to be expressed in HepG2)

IHC (Immunohistochemistry)

(Human Testis)

product-image-AAA23561_IHC2.jpg IHC (Immunohistochemistry) (Human Testis)

IHC (Immunohistochemistry)

(Human Testis)

product-image-AAA23561_IHC.jpg IHC (Immunohistochemistry) (Human Testis)
Related Product Information for anti-IDH1 antibody
This is a rabbit polyclonal antibody against IDH1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production.Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
isocitrate dehydrogenase
NCBI Official Synonym Full Names
isocitrate dehydrogenase (NADP(+)) 1, cytosolic
NCBI Official Symbol
IDH1
NCBI Official Synonym Symbols
IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26
NCBI Protein Information
isocitrate dehydrogenase [NADP] cytoplasmic
UniProt Protein Name
Isocitrate dehydrogenase [NADP] cytoplasmic
UniProt Gene Name
IDH1
UniProt Synonym Gene Names
PICD; IDH
UniProt Entry Name
IDHC_HUMAN

Similar Products

Product Notes

The IDH1 idh1 (Catalog #AAA23561) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IDH1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IDH1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the IDH1 idh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSIETIEAGF MTKDLAACIK GLPNVQRSDY LNTFEFMDKL GENLKIKLAQ. It is sometimes possible for the material contained within the vial of "IDH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.