Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199895_WB10.jpg WB (Western Blot) (WB Suggested Anti-IDH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

Rabbit IDH2 Polyclonal Antibody | anti-IDH2 antibody

IDH2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
IDH2; IDH; IDP; IDHM; IDPM; ICD-M; D2HGA2; mNADP-IDH
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IDH2, Antibody; IDH2 antibody - middle region; anti-IDH2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK
Sequence Length
452
Applicable Applications for anti-IDH2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IDH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IDH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

product-image-AAA199895_WB10.jpg WB (Western Blot) (WB Suggested Anti-IDH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

WB (Western Blot)

(IDH2 antibody - middle region validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.)

product-image-AAA199895_WB11.jpg WB (Western Blot) (IDH2 antibody - middle region validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.)

WB (Western Blot)

(Host: RabbitTarget Name: IDH2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

product-image-AAA199895_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: IDH2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: IDH2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

product-image-AAA199895_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: IDH2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)
Related Product Information for anti-IDH2 antibody
This is a rabbit polyclonal antibody against IDH2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. IDH2 is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex.Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-IDH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
isocitrate dehydrogenase
NCBI Official Synonym Full Names
isocitrate dehydrogenase (NADP(+)) 2, mitochondrial
NCBI Official Symbol
IDH2
NCBI Official Synonym Symbols
IDH; IDP; IDHM; IDPM; ICD-M; D2HGA2; mNADP-IDH
NCBI Protein Information
isocitrate dehydrogenase [NADP], mitochondrial
UniProt Protein Name
Isocitrate dehydrogenase [NADP], mitochondrial
UniProt Gene Name
IDH2
UniProt Synonym Gene Names
IDH
UniProt Entry Name
IDHP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IDH2 idh2 (Catalog #AAA199895) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IDH2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's IDH2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IDH2 idh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGTVFREPII CKNIPRLVPG WTKPITIGRH AHGDQYKATD FVADRAGTFK. It is sometimes possible for the material contained within the vial of "IDH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.