Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201282_WB15.jpg WB (Western Blot) (WB Suggested Anti-IFI30 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIFI30 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit IFI30 Polyclonal Antibody | anti-IFI30 antibody

IFI30 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
IFI30; GILT; IP30; IP-30; IFI-30
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IFI30, Antibody; IFI30 Antibody - middle region; anti-IFI30 antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: YGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCME
Sequence Length
250
Applicable Applications for anti-IFI30 antibody
WB (Western Blot)
Protein Size (#AA)
250 amino acids
Homology
Cow: 86%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 86%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human IFI30
Blocking Peptide
For anti-IFI30 (MBS3216386) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-IFI30 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIFI30 is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA201282_WB15.jpg WB (Western Blot) (WB Suggested Anti-IFI30 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellIFI30 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-IFI30 antibody
This is a rabbit polyclonal antibody against IFI30. It was validated on Western Blot

Target Description: The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing.
Product Categories/Family for anti-IFI30 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
gamma-interferon-inducible lysosomal thiol reductase preproprotein
NCBI Official Synonym Full Names
IFI30 lysosomal thiol reductase
NCBI Official Symbol
IFI30
NCBI Official Synonym Symbols
GILT; IP30; IP-30; IFI-30
NCBI Protein Information
gamma-interferon-inducible lysosomal thiol reductase
UniProt Protein Name
Gamma-interferon-inducible lysosomal thiol reductase
UniProt Gene Name
IFI30
UniProt Synonym Gene Names
GILT; IP30
UniProt Entry Name
GILT_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IFI30 ifi30 (Catalog #AAA201282) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFI30 Antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IFI30 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the IFI30 ifi30 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YGNAQEQNVS GRWEFKCQHG EEECKFNKVE ACVLDELDME LAFLTIVCME. It is sometimes possible for the material contained within the vial of "IFI30, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.