Rabbit anti-Human IFI44L Polyclonal Antibody | anti-IFI44L antibody
IFI44L antibody - N-terminal region
Gene Names
IFI44L; GS3686; C1orf29
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
IFI44L, Antibody; IFI44L antibody - N-terminal region; anti-IFI44L antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
Sequence Length
413
Applicable Applications for anti-IFI44L antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IFI44L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-IFI44L antibody
This is a rabbit polyclonal antibody against IFI44L. It was validated on Western Blot and immunohistochemistry
Target Description: The function remains known.
Target Description: The function remains known.
Product Categories/Family for anti-IFI44L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
47kDa
NCBI Official Full Name
interferon-induced protein 44-like
NCBI Official Synonym Full Names
interferon induced protein 44 like
NCBI Official Symbol
IFI44L
NCBI Official Synonym Symbols
GS3686; C1orf29
NCBI Protein Information
interferon-induced protein 44-like
Similar Products
Product Notes
The IFI44L (Catalog #AAA199679) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFI44L antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFI44L can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the IFI44L for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEVTTRLTWN DENHLRKLLG NVSLSLLYKS SVHGGSIEDM VERCSRQGCT. It is sometimes possible for the material contained within the vial of "IFI44L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
